![[ICO]](/icons/blank.gif) | Name | Last modified | Size | Description |
|
![[SND]](/icons/sound2.gif) | X2Download.com - Astral step X GAZ (mashup) (128 kbps).mp3 | 2022-08-14 22:39 | 0 | |
![[SND]](/icons/sound2.gif) | Copi06.mp3 | 2022-08-14 22:37 | 0 | |
![[SND]](/icons/sound2.gif) | dog4.mp3 | 2022-08-14 22:33 | 0 | |
![[SND]](/icons/sound2.gif) | TW.mp3 | 2022-08-14 22:26 | 0 | |
![[SND]](/icons/sound2.gif) | FaziKun.mp3 | 2022-08-14 22:25 | 0 | |
![[VID]](/icons/movie.gif) | A-Flock-of-Seagulls-Wishing-Long.mp4 | 2022-08-14 22:22 | 0 | |
![[SND]](/icons/sound2.gif) | no-love.mp3 | 2022-08-14 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | 𝑓𝑖𝑛𝑖𝑘_ya _kyry(www.lightaudio.ru).mp3 | 2022-08-14 22:18 | 0 | |
![[SND]](/icons/sound2.gif) | A Flock of Seagulls - Wishing (Long Version).mp3 | 2022-08-14 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | 𝑓𝑖𝑛𝑖𝑘 — Я курю гашиш любого сорта (www.lightaudio.ru).mp3 | 2022-08-14 22:09 | 0 | |
![[SND]](/icons/sound2.gif) | gb.mp3.mp3 | 2022-08-14 22:03 | 0 | |
![[SND]](/icons/sound2.gif) | Jakone.mp3 | 2022-08-14 21:56 | 0 | |
![[SND]](/icons/sound2.gif) | GAYAZOVBROTHER.mp3 | 2022-08-14 21:56 | 0 | |
![[SND]](/icons/sound2.gif) | Soullbeatzprod - Pasha.PeL (mp3-2020.com).mp3 | 2022-08-14 21:54 | 0 | |
![[SND]](/icons/sound2.gif) | 10 Found.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 08 Don't Say.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 02 Wedding Bells.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 06 Let's Go (ft. Karmin).mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 04 Neon.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 03 Mr. Nice Guy.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | 07 What Do I Mean.mp3 | 2022-08-14 21:53 | 0 | |
![[SND]](/icons/sound2.gif) | Shubh - No Love(PagalWorld.com.se) (1).mp3 | 2022-08-14 21:52 | 0 | |
![[SND]](/icons/sound2.gif) | 14 Dear God.mp3 | 2022-08-14 21:52 | 0 | |
![[SND]](/icons/sound2.gif) | 13 Hey We're Gonna Be Alright.mp3 | 2022-08-14 21:51 | 0 | |
![[SND]](/icons/sound2.gif) | 12 Don't Tell Anyone.mp3 | 2022-08-14 21:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ae Dil Hai Mushkil Title Track Pritam 320 Kbps.mp3 | 2022-08-14 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | nicebeatzprod-ya-poplyla-v-okean-sshila-krasnyj-sarafan-remiks-tik-tok.mp3 | 2022-08-14 21:37 | 0 | |
![[SND]](/icons/sound2.gif) | [FREE] Hazardous - Central Cee x AG Suspect x 2Smokeyy x Digga D x AJ Tracey Type Beat wo Hook.mp3 | 2022-08-14 21:27 | 0 | |
![[SND]](/icons/sound2.gif) | ytmp3free.cc_shouse-wont-forget-you-youtubemp3free.org(1).mp3 | 2022-08-14 21:11 | 0 | |
![[SND]](/icons/sound2.gif) | ft khareji.mp3 | 2022-08-14 21:10 | 0 | |
![[SND]](/icons/sound2.gif) | babykif14.mp3 | 2022-08-14 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | tamguc.mp3 | 2022-08-14 21:05 | 1.7M | |
![[SND]](/icons/sound2.gif) | Tama1.mp3 | 2022-08-14 20:56 | 4.2M | |
![[SND]](/icons/sound2.gif) | 7130183086977141531.mp3 | 2022-08-14 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | tama1.mp3 | 2022-08-14 20:50 | 0 | |
![[SND]](/icons/sound2.gif) | ochen_krutojj_muzhik_shashlyk_shashlychok_slowed_reverb_74462085.mp3 | 2022-08-14 20:45 | 0 | |
![[SND]](/icons/sound2.gif) | SELAMAT ULANG TAHUN MUSIKALISASI PUISI story wa selamat ulang tahun.mp3 | 2022-08-14 20:42 | 0 | |
![[SND]](/icons/sound2.gif) | ochen_krutojj_muzhik_-_shashlyk_shashlychok_slowed_reverb_74462085 (1).mp3 | 2022-08-14 20:41 | 0 | |
![[SND]](/icons/sound2.gif) | beatbxo.mp3 | 2022-08-14 20:39 | 0 | |
![[SND]](/icons/sound2.gif) | ochenkrutojjmuzhikshashlykshashlychokslowedreverb.mp3 | 2022-08-14 20:39 | 0 | |
![[SND]](/icons/sound2.gif) | isalang.mp3 | 2022-08-14 20:35 | 4.0M | |
![[SND]](/icons/sound2.gif) | BCLL.mp3 | 2022-08-14 20:34 | 0 | |
![[SND]](/icons/sound2.gif) | pagsamo.mp3 | 2022-08-14 20:34 | 4.6M | |
![[SND]](/icons/sound2.gif) | tahanan.mp3 | 2022-08-14 20:34 | 4.6M | |
![[SND]](/icons/sound2.gif) | paraluman.mp3 | 2022-08-14 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | ikawlang.mp3 | 2022-08-14 20:33 | 4.0M | |
![[SND]](/icons/sound2.gif) | higa.mp3 | 2022-08-14 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | mahika.mp3 | 2022-08-14 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | ulukmanapo-aziatskaja-jestetika_92658679.mp3 | 2022-08-14 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | nrvn.mp3 | 2022-08-14 20:30 | 0 | |
![[SND]](/icons/sound2.gif) | Jakone_A_V_G_Itachi_Kurit.mp3 | 2022-08-14 20:30 | 0 | |
![[SND]](/icons/sound2.gif) | Gym_Class_Heroes_-_Stereo_Hearts_48379620.mp3 | 2022-08-14 20:29 | 0 | |
![[SND]](/icons/sound2.gif) | 163ONMYNECKBUSHIDOZHOSTOMATOLOGICHKA73829298.mp3 | 2022-08-14 20:29 | 0 | |
![[SND]](/icons/sound2.gif) | Pantheon, The Unbreakable Spear Champion Theme - League of Legends.mp3 | 2022-08-14 20:27 | 0 | |
![[SND]](/icons/sound2.gif) | ochenkrutojjmuzhikshashlykshashlychokslowedreverb74462085.mp3 | 2022-08-14 20:26 | 0 | |
![[SND]](/icons/sound2.gif) | Bronze Radio Return - Everything Moves.mp3 | 2022-08-14 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | cümbüşçü-dayılar-uçusa-geçen-abimiz (online-audio-converter.com).mp3 | 2022-08-14 20:16 | 0 | |
![[SND]](/icons/sound2.gif) | august12.mp3 | 2022-08-14 20:12 | 0 | |
![[SND]](/icons/sound2.gif) | august 12.mp3 | 2022-08-14 20:11 | 0 | |
![[SND]](/icons/sound2.gif) | song2.mp3 | 2022-08-14 20:09 | 1.8M | |
![[SND]](/icons/sound2.gif) | INSTASAMKA - MONEYKEN LOVE.mp3 | 2022-08-14 20:04 | 0 | |
![[SND]](/icons/sound2.gif) | ParaParaan.mp3 | 2022-08-14 20:04 | 0 | |
![[SND]](/icons/sound2.gif) | req21.mp3.mp3 | 2022-08-14 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Paraan.mp3 | 2022-08-14 19:59 | 0 | |
![[SND]](/icons/sound2.gif) | ALEN SAKI x THCF ZORE PIJANE 2 OFFICIAL VIDEO.mp3 | 2022-08-14 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | 124961357619279481271492712.mp3 | 2022-08-14 19:39 | 0 | |
![[SND]](/icons/sound2.gif) | Moonlight.mp3 | 2022-08-14 19:38 | 0 | |
![[VID]](/icons/movie.gif) | 14_अगस्त_2022_का_दिनभर__पूरा_दिन_पूरी_ख़बर_सुनिए_मानसी_दाश_के_साथ_BBC_Hindi.mp4 | 2022-08-14 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | The_Neighbourhood_-_You_Get_Me_So_High_49021712.mp3 | 2022-08-14 19:34 | 0 | |
![[SND]](/icons/sound2.gif) | wtorek1.mp3 | 2022-08-14 19:23 | 0 | |
![[SND]](/icons/sound2.gif) | djkane6.mp3 | 2022-08-14 19:23 | 2.4M | |
![[SND]](/icons/sound2.gif) | Wgk.mp3 | 2022-08-14 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | Vp7.mp3 | 2022-08-14 19:05 | 0 | |
![[SND]](/icons/sound2.gif) | Halika.mp3 | 2022-08-14 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | ridinhigh.mp3 | 2022-08-14 19:00 | 0 | |
![[SND]](/icons/sound2.gif) | bcfl.mp3 | 2022-08-14 18:58 | 0 | |
![[SND]](/icons/sound2.gif) | glimpose of us lalala.mp3 | 2022-08-14 18:58 | 0 | |
![[SND]](/icons/sound2.gif) | takbo.mp3 | 2022-08-14 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | Jian.mp3.mp3 | 2022-08-14 18:53 | 0 | |
![[SND]](/icons/sound2.gif) | UNDER.mp3 | 2022-08-14 18:53 | 0 | |
![[SND]](/icons/sound2.gif) | gudds.mp3 | 2022-08-14 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | Clairo - Sofia.mp3 | 2022-08-14 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | pfruitdrake.mp3 | 2022-08-14 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | FOUR.mp3.mp3 | 2022-08-14 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | THREE.mp3.mp3 | 2022-08-14 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | viral3.mp3 | 2022-08-14 18:46 | 0 | |
![[SND]](/icons/sound2.gif) | Vp2.mp3 | 2022-08-14 18:46 | 2.4M | |
![[SND]](/icons/sound2.gif) | Vp3.mp3 | 2022-08-14 18:46 | 80K | |
![[SND]](/icons/sound2.gif) | hop.mp3 | 2022-08-14 18:44 | 0 | |
![[SND]](/icons/sound2.gif) | rorp.mp3 | 2022-08-14 18:43 | 0 | |
![[SND]](/icons/sound2.gif) | Casablanca - Nuha Bahrin & Naufal Azrin (Lirik Lagu Terjemahan) - TikTok Viral (64 kbps) (https___youtube-to-mp3.id_).mp3 | 2022-08-14 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | vitalya-dzha-pohuj-molodoj.mp3 | 2022-08-14 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | Vocaroo 1hUOLu6VQNx4.mp3 | 2022-08-14 18:40 | 0 | |
![[SND]](/icons/sound2.gif) | Nkeeei - Что за красотка среди этой массовки.mp3 | 2022-08-14 18:40 | 0 | |
![[SND]](/icons/sound2.gif) | 3.mp3.mp3 | 2022-08-14 18:38 | 0 | |
![[SND]](/icons/sound2.gif) | ARCHI - Тёмное солнце.mp3 | 2022-08-14 18:35 | 0 | |
![[SND]](/icons/sound2.gif) | P.P.P. (Black) _ DAMONNGGOLOIDZ.mp3 | 2022-08-14 18:35 | 460K | |
![[SND]](/icons/sound2.gif) | KK.mp3 | 2022-08-14 18:35 | 814K | |
![[SND]](/icons/sound2.gif) | LMO1.mp3 | 2022-08-14 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | Sabu_HAN_-_Tancujj_66117302.mp3 | 2022-08-14 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - AKAMSI JAYA JAYA MANGBORIS Feat Milly Lolox Loki Official Audio.mp3 | 2022-08-14 18:23 | 0 | |
![[SND]](/icons/sound2.gif) | Дмитрий Нестеров - Шашлычок.mp3 | 2022-08-14 18:22 | 0 | |
![[SND]](/icons/sound2.gif) | RidinHigh.mp3 | 2022-08-14 18:21 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Yêu Giang Sơn Càng Yêu Mỹ Nhân Thiên Tú.mp3 | 2022-08-14 18:20 | 124K | |
![[SND]](/icons/sound2.gif) | sneeze2.mp3 | 2022-08-14 18:19 | 0 | |
![[SND]](/icons/sound2.gif) | lv_0_20220815005602.mp3 | 2022-08-14 18:12 | 0 | |
![[SND]](/icons/sound2.gif) | m1.mp3 | 2022-08-14 18:11 | 320K | |
![[SND]](/icons/sound2.gif) | Methu-Methuvaga-Payanangal.mp3 | 2022-08-14 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | sershenzaritskaya-journey-separate-ways-worlds-apart-cover-by-sershenzaritskaya-feat-kim-and-shturmak(mp3new.cc) (1).mp3 | 2022-08-14 18:10 | 0 | |
![[SND]](/icons/sound2.gif) | background_guide1.mp3 | 2022-08-14 18:07 | 0 | |
![[SND]](/icons/sound2.gif) | thallu1.mp3 | 2022-08-14 18:05 | 0 | |
![[SND]](/icons/sound2.gif) | Крик-биомусора-_-восстановление-условий-содержания-scp-106.mp3 | 2022-08-14 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | A01.mp3 | 2022-08-14 18:00 | 0 | |
![[SND]](/icons/sound2.gif) | اومدی خ (online-audio-converter.com).mp3 | 2022-08-14 17:55 | 0 | |
![[VID]](/icons/movie.gif) | A1.mp4 | 2022-08-14 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | C1.mp3 | 2022-08-14 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | pau12.mp3 | 2022-08-14 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | koko.mp3 | 2022-08-14 17:44 | 2.7M | |
![[SND]](/icons/sound2.gif) | pau11.mp3 | 2022-08-14 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | pau10.mp3 | 2022-08-14 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | Shahin Jamshidpour - Dil Yarasi _ Azeri Music [OFFICIAL].mp3 | 2022-08-14 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | A2.mp3 | 2022-08-14 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | Justin.mp3 | 2022-08-14 17:38 | 2.3M | |
![[SND]](/icons/sound2.gif) | Bongo Bong.mp3 | 2022-08-14 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | pau9.mp3 | 2022-08-14 17:37 | 0 | |
![[SND]](/icons/sound2.gif) | pau8.mp3 | 2022-08-14 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | pau7.mp3 | 2022-08-14 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | Lukenzi.mp3 | 2022-08-14 17:31 | 0 | |
![[SND]](/icons/sound2.gif) | A1.mp3 | 2022-08-14 17:31 | 0 | |
![[SND]](/icons/sound2.gif) | pau6.mp3 | 2022-08-14 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | Armada4.mp3 | 2022-08-14 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | mp4.mp3 | 2022-08-14 17:29 | 3.2M | |
![[SND]](/icons/sound2.gif) | Suara.mp3 | 2022-08-14 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | เปิดดัง ระวังเอวเด้งน๊ะจ๊ะ ตื๊ดยับโคตรมันส์2022 DANCETAMJAI.mp3 | 2022-08-14 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | Car life - Race ( OST my summer car )_.mp3 | 2022-08-14 17:28 | 0 | |
![[SND]](/icons/sound2.gif) | pau5.mp3 | 2022-08-14 17:28 | 0 | |
![[SND]](/icons/sound2.gif) | ganja.mp3 | 2022-08-14 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | pau3.mp3 | 2022-08-14 17:22 | 0 | |
![[SND]](/icons/sound2.gif) | xAPSbe.mp3 | 2022-08-14 17:18 | 0 | |
![[SND]](/icons/sound2.gif) | Stenli.mp3 | 2022-08-14 17:18 | 0 | |
![[SND]](/icons/sound2.gif) | tina.mp3 | 2022-08-14 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | ERA_-_Ameno.mp3 | 2022-08-14 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - status WhatsApp 30detiklirik lagu romantis buat pacar (2).mp3 | 2022-08-14 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | radok1.mp3 | 2022-08-14 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | Lost Frequencies & Calum Scott - Where Are You Now (Lyrics) (mp3cut.net).mp3 | 2022-08-14 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | Zylglen.mp3 | 2022-08-14 17:11 | 0 | |
![[SND]](/icons/sound2.gif) | TOAL.mp3 | 2022-08-14 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | djjudi1.mp3 | 2022-08-14 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | djjudi2.mp3 | 2022-08-14 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | ocean.mp3 | 2022-08-14 17:04 | 0 | |
![[SND]](/icons/sound2.gif) | AEF3e_Level_3_SB_5.09.mp3 | 2022-08-14 16:59 | 0 | |
![[SND]](/icons/sound2.gif) | judi3.m4a | 2022-08-14 16:59 | 0 | |
![[SND]](/icons/sound2.gif) | judi2.mp3 | 2022-08-14 16:58 | 0 | |
![[SND]](/icons/sound2.gif) | judi1.mp3 | 2022-08-14 16:57 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - status WhatsApp 30detiklirik lagu romantis buat pacar (1).mp3 | 2022-08-14 16:54 | 0 | |
![[SND]](/icons/sound2.gif) | pau2.mp3.mp3 | 2022-08-14 16:53 | 0 | |
![[SND]](/icons/sound2.gif) | rakitatta.mp3 | 2022-08-14 16:52 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Оркестър Камчия Комбайнавършачка.mp3 | 2022-08-14 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | star.mp3 | 2022-08-14 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | TT.mp3 | 2022-08-14 16:41 | 2.5M | |
![[SND]](/icons/sound2.gif) | Marce.mp3 | 2022-08-14 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | LAYANGAN.mp3 | 2022-08-14 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | Lex.mp3 | 2022-08-14 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | Young.mp3 | 2022-08-14 16:27 | 1.0M | |
![[SND]](/icons/sound2.gif) | Badut.mp3 | 2022-08-14 16:26 | 5.8M | |
![[SND]](/icons/sound2.gif) | ANL.mp3 | 2022-08-14 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | NetuH - BOSOZOKU.mp3 | 2022-08-14 16:19 | 0 | |
![[SND]](/icons/sound2.gif) | Rizky Febian - Seperti Kisah [Official Lyric Video].mp3 | 2022-08-14 16:19 | 4.5M | |
![[SND]](/icons/sound2.gif) | KSLV - Dog Ate Dog.mp3 | 2022-08-14 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | finesse scar - finish him (finish him).mp3 | 2022-08-14 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | troye sivan - angel baby (tiktok version).mp3 | 2022-08-14 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | titan.mp3 | 2022-08-14 16:12 | 0 | |
![[SND]](/icons/sound2.gif) | angelbaby.mp3 | 2022-08-14 16:09 | 0 | |
![[SND]](/icons/sound2.gif) | Ne1.mp3 | 2022-08-14 16:06 | 0 | |
![[SND]](/icons/sound2.gif) | ballas.mp3 | 2022-08-14 15:57 | 1.0M | |
![[SND]](/icons/sound2.gif) | New National Anthem Diamond Jubilee Pakistan 75 Years.mp3 | 2022-08-14 15:57 | 3.1M | |
![[SND]](/icons/sound2.gif) | red_hot_chilli_peppers-dark_necessities.mp3 | 2022-08-14 15:54 | 7.0M | |
![[SND]](/icons/sound2.gif) | Seeyouagain.mp3 | 2022-08-14 15:52 | 3.6M | |
![[SND]](/icons/sound2.gif) | A.mp3 | 2022-08-14 15:52 | 4.9M | |
![[SND]](/icons/sound2.gif) | michael.mp3 | 2022-08-14 15:52 | 1.0M | |
![[SND]](/icons/sound2.gif) | Lexilore.mp3 | 2022-08-14 15:52 | 68K | |
![[SND]](/icons/sound2.gif) | Kriminal.mp3 | 2022-08-14 15:51 | 2.2M | |
![[SND]](/icons/sound2.gif) | Bone.mp3 | 2022-08-14 15:51 | 1.3M | |
![[SND]](/icons/sound2.gif) | Billionaires.mp3 | 2022-08-14 15:51 | 0 | |
![[SND]](/icons/sound2.gif) | MYR.mp3 | 2022-08-14 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | Bea.mp3 | 2022-08-14 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | neram450.mp3 | 2022-08-14 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | neran345.mp3 | 2022-08-14 15:48 | 0 | |
![[VID]](/icons/movie.gif) | audioclip-1660486916000-49436.mp4 | 2022-08-14 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Balti - Allo (Official Music Video)[Mpgun.com].mp3 | 2022-08-14 15:46 | 0 | |
![[SND]](/icons/sound2.gif) | DbBkL!.mp3 | 2022-08-14 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | Samir loussif bent el hay YouTube[Mpgun.com].mp3 | 2022-08-14 15:41 | 0 | |
![[SND]](/icons/sound2.gif) | EZ.mp3 | 2022-08-14 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa999.MP.mp3 | 2022-08-14 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | bcrpsong.mp3 | 2022-08-14 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | VtMnD!.mp3 | 2022-08-14 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa99.MP.mp3 | 2022-08-14 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | bcrp.mp3 | 2022-08-14 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | CCL.mp3 | 2022-08-14 15:33 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa9.MP.mp3 | 2022-08-14 15:33 | 0 | |
![[SND]](/icons/sound2.gif) | Mannmera.mp3 | 2022-08-14 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | lafur-Arnalds-Only-The-Winds.mp3 | 2022-08-14 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa6.mp3 | 2022-08-14 15:31 | 1.2M | |
![[SND]](/icons/sound2.gif) | Boo.mp3 | 2022-08-14 15:31 | 499K | |
![[SND]](/icons/sound2.gif) | lexilore.mp3 | 2022-08-14 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | bea.mp3 | 2022-08-14 15:29 | 352K | |
![[SND]](/icons/sound2.gif) | naren344.mp3 | 2022-08-14 15:28 | 377K | |
![[SND]](/icons/sound2.gif) | bone.mp3 | 2022-08-14 15:25 | 1.3M | |
![[SND]](/icons/sound2.gif) | Timati_-_Tantum_Verde_orte_64567949.mp3 | 2022-08-14 15:24 | 360K | |
![[SND]](/icons/sound2.gif) | sad13.mp3 | 2022-08-14 15:20 | 2.8M | |
![[SND]](/icons/sound2.gif) | sad12.mp3 | 2022-08-14 15:19 | 3.1M | |
![[SND]](/icons/sound2.gif) | sad11.mp3 | 2022-08-14 15:19 | 4.0M | |
![[SND]](/icons/sound2.gif) | sad10.mp3 | 2022-08-14 15:19 | 3.1M | |
![[SND]](/icons/sound2.gif) | sad3.mp3 | 2022-08-14 15:19 | 160K | |
![[SND]](/icons/sound2.gif) | banger.mp3 | 2022-08-14 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | sad9.mp3 | 2022-08-14 15:17 | 2.4M | |
![[SND]](/icons/sound2.gif) | MP40.mp3 | 2022-08-14 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | Strong.mp3 | 2022-08-14 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | banger_c.mp3 | 2022-08-14 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | krokodil-chik-prosto-klass-veselaya-pesnya.mp3 | 2022-08-14 15:13 | 640K | |
![[SND]](/icons/sound2.gif) | 2.mp3.mp3 | 2022-08-14 15:12 | 3.5M | |
![[SND]](/icons/sound2.gif) | E!FSs.mp3 | 2022-08-14 15:08 | 0 | |
![[SND]](/icons/sound2.gif) | chekele.mp3 | 2022-08-14 15:05 | 0 | |
![[SND]](/icons/sound2.gif) | 2008 Ani Lorak (ÐÐ½Ñ ÐоÑак) - Shady Lady (Instrumental Version) (5)(online-audio-convert.com).mp3 | 2022-08-14 15:05 | 576K | |
![[SND]](/icons/sound2.gif) | sad8.mp3 | 2022-08-14 15:04 | 2.5M | |
![[SND]](/icons/sound2.gif) | sad7.mp3 | 2022-08-14 15:04 | 3.6M | |
![[SND]](/icons/sound2.gif) | 1.mp3.mp3 | 2022-08-14 15:04 | 2.8M | |
![[VID]](/icons/movie.gif) | Ani Lorak - Shady Lady (Ukraine) 2008 Eurovision Song Contest.mp4 | 2022-08-14 15:04 | 552K | |
![[SND]](/icons/sound2.gif) | sad5.mp3 | 2022-08-14 15:04 | 3.6M | |
![[SND]](/icons/sound2.gif) | sad4.mp3 | 2022-08-14 15:03 | 1.7M | |
![[SND]](/icons/sound2.gif) | Sad2.mp3 | 2022-08-14 15:03 | 892K | |
![[SND]](/icons/sound2.gif) | byJo.mp3 | 2022-08-14 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | Sad1.mp3 | 2022-08-14 15:03 | 1.8M | |
![[SND]](/icons/sound2.gif) | all by my lonely.mp3 | 2022-08-14 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | sad6.mp3 | 2022-08-14 15:02 | 3.3M | |
![[VID]](/icons/movie.gif) | Project.mp4 | 2022-08-14 15:01 | 0 | |
![[SND]](/icons/sound2.gif) | pay_money.mp3 | 2022-08-14 15:01 | 7.8K | |
![[SND]](/icons/sound2.gif) | DjP.OdB!.mp3 | 2022-08-14 15:00 | 0 | |
![[VID]](/icons/movie.gif) | VE Project 1-highlight.mp4 | 2022-08-14 15:00 | 0 | |
![[VID]](/icons/movie.gif) | 2008 Ani Lorak (Ані Лорак) - Shady Lady (Instrumental Version).mp4 | 2022-08-14 15:00 | 0 | |
![[VID]](/icons/movie.gif) | Л.mp4 | 2022-08-14 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | Mustafa_Sandal_-_Araba_2004_(musmore.com).mp3 | 2022-08-14 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | Shake it - Sakis Rouvas from backingtracks.co.mp3 | 2022-08-14 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | kaduva.mp3.mp3 | 2022-08-14 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | hig.mp3 | 2022-08-14 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | highlight.mp3 | 2022-08-14 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Klitihwasu.mp3 | 2022-08-14 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Click.mp3 | 2022-08-14 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | kaduvasong.mp3 | 2022-08-14 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | electro-light-symbolism-ncs-release-128-ytshorts.savetube.me.mp3 | 2022-08-14 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | ty-menya-ne-ponyala-i-s-drugim-gulyat-poshla-pesnya-tiktok-remiks.mp3 | 2022-08-14 14:51 | 0 | |
![[SND]](/icons/sound2.gif) | DjPxOdB1.mp3 | 2022-08-14 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | Nateman.mp3.mp3 | 2022-08-14 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | MCLP.mp3 | 2022-08-14 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | Научно-технический рэп - Папины гены.mp3 | 2022-08-14 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | Art_Student_Package_|_ARTISTIC_|_Luminals(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | —_eхтreмely_powerғυl_❝_art_hoe_package_❞_✺_subliminal_−−☆(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | %5B_Art___Manhwa_Manga_Subliminal_%5D(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | desired_art_style_|_Forced_Subliminal_-_Peachymilk.mp4(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | %E0%BC%84_%E2%9C%A7.%E2%8B%86_most_POWERFUL_ultimate_artist_pack____frequency_____get_better_at_drawing_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Draw_everything_you_see_in_your_mind!_[SUBLIMINAL](128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 𝘼𝙧𝙩𝙞𝙨𝙩_𝘾𝙤𝙢𝙗𝙤;_+_𝙎𝙠𝙞𝙡𝙡𝙨_𝙞𝙣_𝙋𝙚𝙧𝙛𝙤𝙧𝙢𝙞𝙣𝙜_𝙞𝙣_7_𝘿𝙖𝙮𝙨_✧_𝙨𝙪𝙗𝙡𝙞𝙢𝙞𝙣𝙖𝙡_(𝙡𝙞𝙨𝙩𝙚𝙣_(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | -ˏˋ_art_student_combo_࿐ྂ_forced_subliminal_ˊˎ-(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ultimate_Visual_Arts_Genius_Subliminal____Creativity___Artistic_Abilities(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | •art_style•(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | %EA%A7%81%E2%9D%9D%E1%B4%85%E1%B4%80_%E1%B4%A0%C9%AA%C9%B4%E1%B4%84%C9%AA_%E1%B4%84%E1%B4%8F%E1%B4%9C%CA%9F%E1%B4%85_%C9%B4%E1%B4%87%E1%B4%A0%E1%B4%87%CA%80%21%E2%9D%9E%E2%9E%B5art_combo____extremely_powerful_and_detailed_su(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ultimate_Manga_Art_Subliminal!!!!(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ultimate_artist_Subliminal_bundle_|_Samsubs(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 🎨ART_BUNDLE🎨(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Art_combo_subliminal_(_request_)_become_the_perfect_artist(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 「_Artist_」|subliminal|(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ART_GENIUS_FORCED___INSTANT_SUBLIMINAL_BUNDLE_%E2%9C%A8____cloudy_subliminal_%E2%98%81%EF%B8%8F(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 🎨ART(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ꒰🖇꒱_𝕔𝕣𝕖𝕒𝕥𝕚𝕧𝕖_˚⋆_✎_improve_art_and_animation_|_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | *POWERFUL*_EXTREME_CREATIVITY_+_HIGH_IQ_+_TALENT_PACK_+_more_[subliminal_visual+audio]_+_432hz(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | *°~ART_SKILL_IMPROVEMENT_&_more~°*_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Be_Great_in_Art_subliminal_•_Alkaline_affirmations(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | WORLD'S_BEST_Art_Combo_||_Subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Be_a_digital_artist_|_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | __New_Formula___Forced_Talent___Artist_Subliminal_-_Super_Artistic%2C_Creative___Inspired_5.2k__affs(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Sketched_%E2%80%A2_HUGE_ART_COMBO_%E2%99%A1____subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Become_an_Amazing_Artist_||_Subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ultimate_Artist_༄_Subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | —🖊drawing_tablet_+_art_skills。;_✦subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 💖_Artist_combo_💖_Request_(improved_ver.)(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | 🌹Art_Enhancement_Potion🌹|_Calm(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ☼_become_a_good_drawer_☼【subliminal_by:_aki】(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | art_hoe_pack_❋_kiki_subliminals(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | become a talented & famous artist || subliminal ⋆.m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Make_It_As_An_Artist_[REQUESTED_-_UNISEX]_♡_Subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Attract_Money,_Wealth,_Luck_&_Prosperity_Strong_Affirmations(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | attract_money_and_wealth_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ⚠️_ATTRACT_MONEY_➷_Subliminal_{strong_affirmations_+_visual_quotes}(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ☆_attract_money_(forced_subliminal)(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ☆_luxurious_lifestyle_(listen_once_subliminal)(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | ✧_Money_and_Wealth_Booster_{powerful_subliminal_audio_affirmations_+_quotes}(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | rich_lifestyle_(money,house,car,etc)_•_forced_subliminal(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | rich_family(128k).m4a | 2022-08-14 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ton4.mp3 | 2022-08-14 14:44 | 0 | |
![[SND]](/icons/sound2.gif) | jXCC.mp3 | 2022-08-14 14:40 | 0 | |
![[SND]](/icons/sound2.gif) | Ez.mp3 | 2022-08-14 14:40 | 1.4M | |
![[SND]](/icons/sound2.gif) | Lagu Indonesia Raya 3 Stanza _ Lagu Kebangsaan Indonesia Raya(MP3_70K)1658041636520.mp3 | 2022-08-14 14:40 | 0 | |
![[SND]](/icons/sound2.gif) | MCL.mp3 | 2022-08-14 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - 4Kings (playlist) (128 kbps).mp3 | 2022-08-14 14:33 | 44K | |
![[SND]](/icons/sound2.gif) | Brian.mp3 | 2022-08-14 14:30 | 3.2M | |
![[SND]](/icons/sound2.gif) | Dugem1.mp3 | 2022-08-14 14:29 | 29M | |
![[SND]](/icons/sound2.gif) | 【MV】鈴木雅之『DADDY _ DADDY _ DO _ feat. 鈴木愛理』TVアニメ「かぐや様は告らせたい_~天才たちの恋愛頭脳戦~」OP主題歌(MP3_70K).mp3 | 2022-08-14 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | 【GUMI】KING【Kanaria】(MP3_320K).mp3 | 2022-08-14 14:27 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy8.mp3 | 2022-08-14 14:26 | 0 | |
![[SND]](/icons/sound2.gif) | xzcsw.mp3 | 2022-08-14 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | asgasf.mp3 | 2022-08-14 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | Kaga.mp3 | 2022-08-14 14:23 | 0 | |
![[SND]](/icons/sound2.gif) | NS.mp3 | 2022-08-14 14:23 | 2.1M | |
![[SND]](/icons/sound2.gif) | Playboi_Carti_-_Vamp_Anthem_72097428.mp3 | 2022-08-14 14:23 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app-_MV_-JJJJ-Bung-Saranghae-_Prod.by-บังจะบิน-_.mp3 | 2022-08-14 14:20 | 0 | |
![[SND]](/icons/sound2.gif) | c12.mp3 | 2022-08-14 14:19 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Latto Big Energy Lyrics.mp3 | 2022-08-14 14:17 | 0 | |
![[SND]](/icons/sound2.gif) | sunandmoon.mp3 | 2022-08-14 14:12 | 0 | |
![[SND]](/icons/sound2.gif) | tcrpintro.mp3 | 2022-08-14 14:11 | 0 | |
![[SND]](/icons/sound2.gif) | Mvnjm.mp3 | 2022-08-14 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | vp7.mp3 | 2022-08-14 14:10 | 0 | |
![[VID]](/icons/movie.gif) | SaveTube.App-(MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp4 | 2022-08-14 14:08 | 0 | |
![[SND]](/icons/sound2.gif) | БэриБитс.mp3 | 2022-08-14 14:07 | 0 | |
![[SND]](/icons/sound2.gif) | Our Prayers-(001).mp3 | 2022-08-14 14:06 | 0 | |
![[SND]](/icons/sound2.gif) | kom.mp3 | 2022-08-14 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | acrpintro.mp3 | 2022-08-14 14:03 | 2.9M | |
![[SND]](/icons/sound2.gif) | appy.mp3 | 2022-08-14 14:01 | 0 | |
![[VID]](/icons/movie.gif) | alt-J - Breezeblocks (Lyrics).mp4 | 2022-08-14 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | MVNJ505.mp3 | 2022-08-14 13:59 | 0 | |
![[VID]](/icons/movie.gif) | alt-J (∆) Breezeblocks.mp4 | 2022-08-14 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | Gimny_-_Gosudarstvennyjj_gimn_Germanskojj_Imperii_Tretego_Rejjkha_48240889.mp3 | 2022-08-14 13:58 | 0 | |
![[SND]](/icons/sound2.gif) | xxxmanera-never-broke-again-mp3.mp3 | 2022-08-14 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | MELVINJ1.mp3 | 2022-08-14 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Oleg_Gazmanov_Vpered_Rossiya_-_Oleg_Gazmanov_Vpered_Rossiya_b128f0d208.mp3 | 2022-08-14 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | komen.mp3 | 2022-08-14 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Михаил Круг - Владимирский Централ.mp3 | 2022-08-14 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Mupp2.mp3 | 2022-08-14 13:54 | 0 | |
![[VID]](/icons/movie.gif) | videoplayback.mp4 | 2022-08-14 13:54 | 4.0M | |
![[SND]](/icons/sound2.gif) | tuconyhok.mp3 | 2022-08-14 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | Pyrokinesis - Сага о маяках и скалах (radio.lol).mp3 | 2022-08-14 13:50 | 0 | |
![[SND]](/icons/sound2.gif) | Paa.mp3 | 2022-08-14 13:48 | 0 | |
![[SND]](/icons/sound2.gif) | acrpintro (2).mp3 | 2022-08-14 13:47 | 0 | |
![[SND]](/icons/sound2.gif) | steddxpyrokinesis.mp3 | 2022-08-14 13:43 | 0 | |
![[SND]](/icons/sound2.gif) | Tests.mp3 | 2022-08-14 13:41 | 0 | |
![[SND]](/icons/sound2.gif) | Komen.mp3 | 2022-08-14 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | acrp.mp3 | 2022-08-14 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | Бэри beat s - number E (Ъ) (freebeat)_(OOSOUND.RU).mp3 | 2022-08-14 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | GTA San Andreas Theme Song Remix.mp3 | 2022-08-14 13:36 | 3.1M | |
![[SND]](/icons/sound2.gif) | sikokbagiduo.mp3 | 2022-08-14 13:36 | 949K | |
![[SND]](/icons/sound2.gif) | 20220723-202316.mp3 | 2022-08-14 13:35 | 1.3M | |
![[SND]](/icons/sound2.gif) | Vp11.mp3 | 2022-08-14 13:34 | 3.5M | |
![[SND]](/icons/sound2.gif) | Vp4.mp3 | 2022-08-14 13:33 | 2.6M | |
![[SND]](/icons/sound2.gif) | bobogart.mp3 | 2022-08-14 13:33 | 0 | |
![[SND]](/icons/sound2.gif) | k1.mp3 | 2022-08-14 13:28 | 0 | |
![[SND]](/icons/sound2.gif) | Бэри.mp3 | 2022-08-14 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Falling In Reverse - _I'm Not A Vampire (Revamped)_.mp3 | 2022-08-14 13:26 | 0 | |
![[SND]](/icons/sound2.gif) | ZZ.mp3 | 2022-08-14 13:21 | 2.1M | |
![[SND]](/icons/sound2.gif) | JOJO8.mp3 | 2022-08-14 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | Vip24.mp3 | 2022-08-14 13:20 | 0 | |
![[VID]](/icons/movie.gif) | Ati242 - Inzaghi [SST FREESTYLE #1].mp4 | 2022-08-14 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | -31-35Hz- Ramil-- MACAN -Screwed- -COSMO SOUND PRODUCTION- -MP3 -🌄Low Bass by Sunrise🌄--kissvk.com.mp3 | 2022-08-14 13:10 | 1.6M | |
![[SND]](/icons/sound2.gif) | xwan37.mp3 | 2022-08-14 13:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | RdV10.mp3 | 2022-08-14 13:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | Pesnya_Skolko_let_mne_uzhe_18_ya_uzhe_sovsem_zabyl.mp3 | 2022-08-14 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | Y2mate.mx - Omori OST - 168 OMORI & 169 OMORI - ALTER (128 kbps).mp3 | 2022-08-14 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | lp999.mp3 | 2022-08-14 12:58 | 0 | |
![[SND]](/icons/sound2.gif) | fake.mp3 | 2022-08-14 12:45 | 3.7M | |
![[SND]](/icons/sound2.gif) | dido.mp3 | 2022-08-14 12:44 | 4.4M | |
![[SND]](/icons/sound2.gif) | slebew.mp3 | 2022-08-14 12:44 | 3.7M | |
![[SND]](/icons/sound2.gif) | Morena.mp3 | 2022-08-14 12:42 | 2.7M | |
![[SND]](/icons/sound2.gif) | strong.mp3 | 2022-08-14 12:42 | 2.4M | |
![[SND]](/icons/sound2.gif) | parai.mp3 | 2022-08-14 12:41 | 0 | |
![[SND]](/icons/sound2.gif) | angel .mp3 | 2022-08-14 12:41 | 0 | |
![[SND]](/icons/sound2.gif) | ktl.mp3 | 2022-08-14 12:41 | 0 | |
![[SND]](/icons/sound2.gif) | STRPMONEY.mp3 | 2022-08-14 12:39 | 0 | |
![[SND]](/icons/sound2.gif) | Dans1.mp3 | 2022-08-14 12:38 | 15M | |
![[SND]](/icons/sound2.gif) | Munting.mp3 | 2022-08-14 12:36 | 2.8M | |
![[SND]](/icons/sound2.gif) | viral2.mp3 | 2022-08-14 12:36 | 4.3M | |
![[SND]](/icons/sound2.gif) | STRTM.mp3 | 2022-08-14 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | PaaSaLupa.mp3 | 2022-08-14 12:33 | 0 | |
![[SND]](/icons/sound2.gif) | Nellyd.mp3 | 2022-08-14 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | Mozart.mp3 | 2022-08-14 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | Lastfragment_-_Karma_(musmore.com).mp3 | 2022-08-14 12:27 | 0 | |
![[SND]](/icons/sound2.gif) | HOSH feat. Jalja-Tighter -feat. Jalja--kissvk.com.mp3 | 2022-08-14 12:27 | 0 | |
![[SND]](/icons/sound2.gif) | viral.mp3 | 2022-08-14 12:27 | 3.4M | |
![[SND]](/icons/sound2.gif) | dj1.mp3 | 2022-08-14 12:24 | 0 | |
![[SND]](/icons/sound2.gif) | sowj01.mp3 | 2022-08-14 12:22 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj1.mp3 | 2022-08-14 12:21 | 0 | |
![[SND]](/icons/sound2.gif) | STR.mp3 | 2022-08-14 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | Life-of-Pazham-MassTamilan.dev.mp3 | 2022-08-14 12:18 | 0 | |
![[SND]](/icons/sound2.gif) | CG2.mp3 | 2022-08-14 12:18 | 0 | |
![[SND]](/icons/sound2.gif) | Munting paraiso.mp3 | 2022-08-14 12:17 | 1.2M | |
![[SND]](/icons/sound2.gif) | Kobo9.mp3 | 2022-08-14 12:14 | 4.1M | |
![[SND]](/icons/sound2.gif) | Maikee's.mp3 | 2022-08-14 12:08 | 0 | |
![[SND]](/icons/sound2.gif) | Kewer.mp3 | 2022-08-14 12:05 | 0 | |
![[SND]](/icons/sound2.gif) | aseli.mp3 | 2022-08-14 12:05 | 0 | |
![[SND]](/icons/sound2.gif) | Your Turn To Die OST - Madman (Kyoujin).mp3 | 2022-08-14 12:03 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Senam Kewer Kewer.mp3 | 2022-08-14 12:02 | 0 | |
![[SND]](/icons/sound2.gif) | DJ CLOSE YOUR EYE x BANGUN TIDUR SELFIE x GO SAMPE BAWAH VIRAL TIK TOK TERBARU 2022!!.mp3 | 2022-08-14 11:59 | 3.5M | |
![[SND]](/icons/sound2.gif) | Close.mp3 | 2022-08-14 11:52 | 2.7M | |
![[SND]](/icons/sound2.gif) | Anweisung M4 (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-14 11:51 | 0 | |
![[SND]](/icons/sound2.gif) | SLT.mp3 | 2022-08-14 11:51 | 0 | |
![[SND]](/icons/sound2.gif) | aarne-bushido-zho-anikv-tesno-mp3.mp3 | 2022-08-14 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | Mamat2.mp3 | 2022-08-14 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | Kagome.mp3.mp3 | 2022-08-14 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | mgmdllv2 💊 - Аккуратно remix ✔.mp3 | 2022-08-14 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | cy123cy567.mp3 | 2022-08-14 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | MigxSandra.mp3 | 2022-08-14 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - You Have Been Hacked-2iyZpwfoBAY-48k-1660473419605.mp3 | 2022-08-14 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | switches sound test.m4a | 2022-08-14 11:35 | 0 | |
![[SND]](/icons/sound2.gif) | Audio.mp3 | 2022-08-14 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | охон🐊 - По любому искал🫀🥷.mp3 | 2022-08-14 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | madina_sahova_darginskaa_(muzebra.top).mp3 | 2022-08-14 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | mountain.mp3.mp3 | 2022-08-14 11:31 | 0 | |
![[VID]](/icons/movie.gif) | Conan Exiles Soundtrack & OST - Darfari Drums Extended.mp4 | 2022-08-14 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | INSTASAMKA_-_LIPSI_HA.mp3.mp3 | 2022-08-14 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | Team4.mp3 | 2022-08-14 11:28 | 0 | |
![[SND]](/icons/sound2.gif) | Team3.mp3 | 2022-08-14 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | Team1.mp3 | 2022-08-14 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | Yanix — FFM Freestyle (www.lightaudio.ru).mp3 | 2022-08-14 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | WT.mp3 | 2022-08-14 11:24 | 0 | |
![[SND]](/icons/sound2.gif) | MELXMVNE, STXTELI - HELLSTRIKE.mp3 | 2022-08-14 11:24 | 0 | |
![[SND]](/icons/sound2.gif) | lonely.mp3.mp3 | 2022-08-14 11:23 | 0 | |
![[SND]](/icons/sound2.gif) | Sadkontol.mp3 | 2022-08-14 11:23 | 0 | |
![[SND]](/icons/sound2.gif) | SIDRENCHIK - In the sky.mp3 | 2022-08-14 11:22 | 0 | |
![[SND]](/icons/sound2.gif) | dingin.mp3 | 2022-08-14 11:15 | 460K | |
![[SND]](/icons/sound2.gif) | djmix.mp3 | 2022-08-14 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | Dots.mp3 | 2022-08-14 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | s.mp3 | 2022-08-14 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | RAP.mp3 | 2022-08-14 11:10 | 2.9M | |
![[SND]](/icons/sound2.gif) | Mikolai Stroinski - After the Storm (yamusic.org).mp3 | 2022-08-14 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | RSTU.mp3 | 2022-08-14 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | yadiA.mp3 | 2022-08-14 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | Kane.mp3 | 2022-08-14 11:05 | 4.3M | |
![[SND]](/icons/sound2.gif) | The world narrows us down if you are absent from us.mp3 | 2022-08-14 11:05 | 0 | |
![[SND]](/icons/sound2.gif) | 256k.mp3 | 2022-08-14 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | Fyp.mp3 | 2022-08-14 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | Unknown artist - Бременские Музыканты Remix Modern Music Bass Boost.mp3 | 2022-08-14 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | Viral.mp3 | 2022-08-14 11:00 | 1.7M | |
![[SND]](/icons/sound2.gif) | snap.mp3 | 2022-08-14 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | hargai.mp3 | 2022-08-14 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | L.mp3 | 2022-08-14 10:56 | 1.9M | |
![[SND]](/icons/sound2.gif) | RICHY.mp3 | 2022-08-14 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ever.mp3 | 2022-08-14 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | SARAN - MR.RICHY FT. 2hox (Official MV).mp3 | 2022-08-14 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | Saran2.mp3 | 2022-08-14 10:46 | 56M | |
![[SND]](/icons/sound2.gif) | Earrape scream.mp3 | 2022-08-14 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | MRE.mp3 | 2022-08-14 10:44 | 3.4M | |
![[SND]](/icons/sound2.gif) | Rick Astley - Never Gonna Give You Up.mp3 | 2022-08-14 10:44 | 4.8M | |
![[SND]](/icons/sound2.gif) | time.mp3 | 2022-08-14 10:42 | 2.8M | |
![[SND]](/icons/sound2.gif) | mix.mp3 | 2022-08-14 10:42 | 8.6M | |
![[SND]](/icons/sound2.gif) | Muli.mp3 | 2022-08-14 10:42 | 4.4M | |
![[SND]](/icons/sound2.gif) | uncle.mp3 | 2022-08-14 10:40 | 670K | |
![[SND]](/icons/sound2.gif) | BABYBIGBOY - SAILOR MOON Feat. 1ST JEANS BlackHeart [PROD.TRILOGY].mp3 | 2022-08-14 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Kesari2.mp3 | 2022-08-14 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | Kaayal.mp3 | 2022-08-14 10:32 | 0 | |
![[SND]](/icons/sound2.gif) | Humdard.mp3 | 2022-08-14 10:32 | 0 | |
![[SND]](/icons/sound2.gif) | Behzad Leito - Mese Khoete [128].mp3 | 2022-08-14 10:31 | 1.7M | |
![[SND]](/icons/sound2.gif) | hold.mp3 | 2022-08-14 10:29 | 3.5M | |
![[SND]](/icons/sound2.gif) | sun.mp3 | 2022-08-14 10:26 | 400K | |
![[SND]](/icons/sound2.gif) | Jamik - Молили небеса.mp3 | 2022-08-14 10:25 | 0 | |
![[VID]](/icons/movie.gif) | httpswww.mp4 | 2022-08-14 10:19 | 3.3M | |
![[SND]](/icons/sound2.gif) | Phonk10.mp3 | 2022-08-14 10:14 | 1.5M | |
![[SND]](/icons/sound2.gif) | udahmk.mp3 | 2022-08-14 10:13 | 2.1M | |
![[SND]](/icons/sound2.gif) | marryme123.mp3 | 2022-08-14 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Foutaise.mp3 | 2022-08-14 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | 6.mp3 | 2022-08-14 10:10 | 40K | |
![[SND]](/icons/sound2.gif) | 4.mp3 | 2022-08-14 10:10 | 2.0M | |
![[SND]](/icons/sound2.gif) | 7.mp3 | 2022-08-14 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | 1.mp3 | 2022-08-14 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | 2.mp3 | 2022-08-14 10:10 | 276K | |
![[SND]](/icons/sound2.gif) | 3.mp3 | 2022-08-14 10:10 | 2.1M | |
![[SND]](/icons/sound2.gif) | minin-zelyonyj-glaz-mp3.mp3 | 2022-08-14 10:08 | 0 | |
![[SND]](/icons/sound2.gif) | djm.mp3 | 2022-08-14 10:08 | 2.7M | |
![[SND]](/icons/sound2.gif) | konfuz_x_kaito_kajf_ty_pojmala_TikTok_mashup_2022.mp3 | 2022-08-14 10:07 | 0 | |
![[SND]](/icons/sound2.gif) | 7075709673738996507.mp3 | 2022-08-14 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | music.mp3 | 2022-08-14 10:01 | 768K | |
![[SND]](/icons/sound2.gif) | ccp lirik lagu dj Close Your Eye x Bangun Tidur Selfi x Go sampe bawah __ viral tik tok.mp3 | 2022-08-14 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Lunatic Princess (Kaguya's Theme) Metal Cover by RichaadEB.mp3 | 2022-08-14 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Vp9.mp3 | 2022-08-14 09:58 | 2.0M | |
![[SND]](/icons/sound2.gif) | Vp12.mp3 | 2022-08-14 09:57 | 3.5M | |
![[SND]](/icons/sound2.gif) | CCP Mentahan Overlay Lirik Lagu 30 Detik 🎶 Dj Angel Baby Trend Tiktok 2022.mp3 | 2022-08-14 09:57 | 567K | |
![[SND]](/icons/sound2.gif) | [Vietsub] Tsuki no Waltz - Isayama Mio.mp3 | 2022-08-14 09:55 | 2.3M | |
![[SND]](/icons/sound2.gif) | r.mp3 | 2022-08-14 09:55 | 45K | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660470397814.mp3 | 2022-08-14 09:54 | 0 | |
![[SND]](/icons/sound2.gif) | ola.mp3 | 2022-08-14 09:45 | 0 | |
![[SND]](/icons/sound2.gif) | 7126491526443617000.mp3 | 2022-08-14 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | ADWS.mp3 | 2022-08-14 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Jangar MSG Official Music Video.mp3 | 2022-08-14 09:38 | 0 | |
![[SND]](/icons/sound2.gif) | sad.mp3 | 2022-08-14 09:35 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN x Витя АК - РАТАТАТАТА (ILYYSHK BEATS REMIX).mp3 | 2022-08-14 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | milos.mp3 | 2022-08-14 09:29 | 0 | |
![[SND]](/icons/sound2.gif) | Twopee Southside _ Aow La Woii [Official Music Video].mp3 | 2022-08-14 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | AML.mp3 | 2022-08-14 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | d.mp3 | 2022-08-14 09:20 | 3.1M | |
![[SND]](/icons/sound2.gif) | bogart4.mp3 | 2022-08-14 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | 1573084064_nebezao__chernaya_pantera_.mp3 | 2022-08-14 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | 10AGEint.mp3 | 2022-08-14 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | Whynot.mp3 | 2022-08-14 09:11 | 0 | |
![[SND]](/icons/sound2.gif) | 10AGE_-_Netu_interesa_72834647.mp3 | 2022-08-14 09:10 | 7.1M | |
![[SND]](/icons/sound2.gif) | udahmasuk.mp3 | 2022-08-14 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | Camou1!.mp3 | 2022-08-14 09:08 | 0 | |
![[SND]](/icons/sound2.gif) | _Animal ДжаZ-3 полоски на кедах -kissvk.com.mp3 | 2022-08-14 09:07 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk11.mp3 | 2022-08-14 09:05 | 0 | |
![[SND]](/icons/sound2.gif) | wroc.mp3 | 2022-08-14 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | INGATAN.mp3 | 2022-08-14 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | killthenoise.mp3 | 2022-08-14 08:59 | 0 | |
![[SND]](/icons/sound2.gif) | Ind.mp3 | 2022-08-14 08:56 | 2.8M | |
![[SND]](/icons/sound2.gif) | 143.mp3 | 2022-08-14 08:51 | 0 | |
![[SND]](/icons/sound2.gif) | Zaky.mp3 | 2022-08-14 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | Kumpas.mp3 | 2022-08-14 08:47 | 4.1M | |
![[SND]](/icons/sound2.gif) | AH.mp3 | 2022-08-14 08:47 | 648K | |
![[SND]](/icons/sound2.gif) | ASU.mp3 | 2022-08-14 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | ASW.mp3 | 2022-08-14 08:47 | 732K | |
![[SND]](/icons/sound2.gif) | PLR.mp3 | 2022-08-14 08:47 | 3.5M | |
![[SND]](/icons/sound2.gif) | Rikhx.mp3 | 2022-08-14 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | vathi coming.mp3 | 2022-08-14 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | DJCuma.mp3 | 2022-08-14 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - INI YANG KALIAN CARI YANG MINTA FULLNYA NI SOUND JJ ZERZSOFTBOY X Ijul RMX.mp3 | 2022-08-14 08:43 | 0 | |
![[SND]](/icons/sound2.gif) | kananjeki.mp3 | 2022-08-14 08:42 | 0 | |
![[SND]](/icons/sound2.gif) | DJ _ KANAN KIRI KANAN KIRI _ GTA V, GTA ROLEPLAY TIKTOK VIRAL TERBARU.mp3 | 2022-08-14 08:39 | 0 | |
![[SND]](/icons/sound2.gif) | MannyManny.mp3 | 2022-08-14 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | Maneh.mp3 | 2022-08-14 08:37 | 0 | |
![[SND]](/icons/sound2.gif) | Kontra.mp3 | 2022-08-14 08:36 | 0 | |
![[SND]](/icons/sound2.gif) | kgf1.mp3 | 2022-08-14 08:35 | 0 | |
![[SND]](/icons/sound2.gif) | aku.mp3 | 2022-08-14 08:34 | 0 | |
![[SND]](/icons/sound2.gif) | kaadhal.mp3 | 2022-08-14 08:34 | 0 | |
![[SND]](/icons/sound2.gif) | Manavaalan Thug - Thallumaala Promo Song _ Tovino Thomas _ Khalid Rahman_ Ashiq Usman _Suhail Backer(MP3_160K).mp3 | 2022-08-14 08:32 | 1.1M | |
![[SND]](/icons/sound2.gif) | Moon.mp3 | 2022-08-14 08:31 | 2.4M | |
![[SND]](/icons/sound2.gif) | Rosa-Linn-SNAP-Lyrics-snapping-1-2-where-are-you_O1AuIj_Xc6c.mp3 | 2022-08-14 08:31 | 0 | |
![[SND]](/icons/sound2.gif) | akulah.mp3 | 2022-08-14 08:26 | 0 | |
![[SND]](/icons/sound2.gif) | AJRHWJFHEN.mp3 | 2022-08-14 08:22 | 0 | |
![[SND]](/icons/sound2.gif) | WORKPLSCUKKKS.mp3 | 2022-08-14 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | akuaja.mp3 | 2022-08-14 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | TW4.mp3 | 2022-08-14 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | inbound8230826314060929341.mp3 | 2022-08-14 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | Kay1.mp3 | 2022-08-14 08:15 | 0 | |
![[SND]](/icons/sound2.gif) | NEWWWEMRPXZYA2022.mp3 | 2022-08-14 08:11 | 0 | |
![[SND]](/icons/sound2.gif) | INL.mp3 | 2022-08-14 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | NEWEMRPABCXZY2022.mp3 | 2022-08-14 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | Mar.mp3 | 2022-08-14 08:02 | 0 | |
![[SND]](/icons/sound2.gif) | Vip0.mp3 | 2022-08-14 08:01 | 0 | |
![[SND]](/icons/sound2.gif) | NEWEMRPXZY2022.mp3 | 2022-08-14 08:00 | 48K | |
![[SND]](/icons/sound2.gif) | KG.mp3 | 2022-08-14 07:59 | 3.3M | |
![[SND]](/icons/sound2.gif) | ASE.mp3 | 2022-08-14 07:57 | 5.8M | |
![[SND]](/icons/sound2.gif) | Mahika.mp3 | 2022-08-14 07:55 | 3.1M | |
![[SND]](/icons/sound2.gif) | ROLEX10.mp3 | 2022-08-14 07:53 | 0 | |
![[SND]](/icons/sound2.gif) | a3.mp3 | 2022-08-14 07:52 | 1.9M | |
![[SND]](/icons/sound2.gif) | Chris Brown - Under The Influence (Audio) (128 kbps).mp3 | 2022-08-14 07:51 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-bandana-albom-mp3.mp3 | 2022-08-14 07:51 | 0 | |
![[SND]](/icons/sound2.gif) | Tri_dnya_dozhdya_-_Vina_73825651.mp3 | 2022-08-14 07:50 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj16.mp3 | 2022-08-14 07:48 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj14.mp3 | 2022-08-14 07:48 | 0 | |
![[SND]](/icons/sound2.gif) | intel.mp3 | 2022-08-14 07:48 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj12.mp3 | 2022-08-14 07:47 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj13.mp3 | 2022-08-14 07:47 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj11.mp3 | 2022-08-14 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj10.mp3 | 2022-08-14 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj9.mp3 | 2022-08-14 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | 14 Aug, 1.14 pm.mp3 | 2022-08-14 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj8.mp3 | 2022-08-14 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj7.mp3 | 2022-08-14 07:44 | 0 | |
![[SND]](/icons/sound2.gif) | sowj6.mp3 | 2022-08-14 07:41 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj5.mp3 | 2022-08-14 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj4.mp3 | 2022-08-14 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj3.mp3 | 2022-08-14 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | Sowj2.mp3 | 2022-08-14 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | NEWEMRP2022.mp3 | 2022-08-14 07:37 | 0 | |
![[SND]](/icons/sound2.gif) | EMRP2022.mp3 | 2022-08-14 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | flutemozart.mp3 | 2022-08-14 07:31 | 0 | |
![[SND]](/icons/sound2.gif) | seph2.mp3 | 2022-08-14 07:31 | 0 | |
![[SND]](/icons/sound2.gif) | 50cent.mp3 | 2022-08-14 07:25 | 0 | |
![[SND]](/icons/sound2.gif) | kompe.mp3 | 2022-08-14 07:20 | 1.1M | |
![[SND]](/icons/sound2.gif) | talk.mp3 | 2022-08-14 07:17 | 2.6M | |
![[SND]](/icons/sound2.gif) | jklj.mp3 | 2022-08-14 07:16 | 188K | |
![[SND]](/icons/sound2.gif) | tingkir.mp3 | 2022-08-14 07:15 | 4.2M | |
![[SND]](/icons/sound2.gif) | 24 - The Vampires Of Venice.mp3 | 2022-08-14 07:15 | 0 | |
![[SND]](/icons/sound2.gif) | thomas.mp3 | 2022-08-14 07:10 | 3.6M | |
![[SND]](/icons/sound2.gif) | Switch1.mp3 | 2022-08-14 07:09 | 1.9M | |
![[SND]](/icons/sound2.gif) | DJ Its My Life x Lalala.mp3 | 2022-08-14 07:09 | 0 | |
![[SND]](/icons/sound2.gif) | mozart1.mp3 | 2022-08-14 07:09 | 0 | |
![[SND]](/icons/sound2.gif) | GTA San Andreas Theme Song Full.mp3 | 2022-08-14 07:08 | 0 | |
![[SND]](/icons/sound2.gif) | xR.mp3 | 2022-08-14 07:06 | 0 | |
![[SND]](/icons/sound2.gif) | แบ่งครึ่ง วัดครึ่งนึง กรรมการครึ่งหนึ่ง !! ตื๊ดๆโคตรมันส์ เพลงแดนซ์2022!! l dj mun remix.mp3 | 2022-08-14 07:05 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Morty - Я пиздатый (bassboosted by pochemydimas)_.mp3 | 2022-08-14 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | nhelongvlc.mp3 | 2022-08-14 07:00 | 2.5M | |
![[SND]](/icons/sound2.gif) | Locco.mp3 | 2022-08-14 07:00 | 2.7M | |
![[SND]](/icons/sound2.gif) | bagi8.mp3 | 2022-08-14 07:00 | 0 | |
![[SND]](/icons/sound2.gif) | Asian.mp3 | 2022-08-14 07:00 | 0 | |
![[SND]](/icons/sound2.gif) | Patron.mp3 | 2022-08-14 06:59 | 0 | |
![[SND]](/icons/sound2.gif) | Thayin Mani.mp3 | 2022-08-14 06:58 | 0 | |
![[SND]](/icons/sound2.gif) | asuh.mp3 | 2022-08-14 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - 𝑻𝒔𝒖𝒏𝒂 (1).mp3 | 2022-08-14 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | asssssssswwwww.mp3 | 2022-08-14 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | kontol.mp3 | 2022-08-14 06:46 | 252K | |
![[SND]](/icons/sound2.gif) | Affar.mp3 | 2022-08-14 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | EMSBABU2.mp3 | 2022-08-14 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | EMSBABU1.mp3 | 2022-08-14 06:42 | 0 | |
![[SND]](/icons/sound2.gif) | ahmetozel.mp3 | 2022-08-14 06:42 | 0 | |
![[SND]](/icons/sound2.gif) | AO3 ALLIN x GUZT - Roo Wai (รู้ไว้) [Official MV].mp3 | 2022-08-14 06:41 | 0 | |
![[SND]](/icons/sound2.gif) | 2ph.mp3 | 2022-08-14 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | loss.mp3 | 2022-08-14 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | Sun.mp3 | 2022-08-14 06:38 | 908K | |
![[SND]](/icons/sound2.gif) | SaveTube.App - หวาดระแวง _ หินเหล็กไฟ [4KINGS] (128 kbps).mp3 | 2022-08-14 06:36 | 0 | |
![[SND]](/icons/sound2.gif) | game.mp3 | 2022-08-14 06:35 | 520K | |
![[SND]](/icons/sound2.gif) | hvcn.mp3 | 2022-08-14 06:35 | 3.1M | |
![[SND]](/icons/sound2.gif) | Test.mp3 | 2022-08-14 06:28 | 529K | |
![[SND]](/icons/sound2.gif) | lupang.mp3 | 2022-08-14 06:26 | 529K | |
![[SND]](/icons/sound2.gif) | Thomas.mp3 | 2022-08-14 06:23 | 3.6M | |
![[SND]](/icons/sound2.gif) | video-1660416922.mp3 | 2022-08-14 06:21 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY15.mp3 | 2022-08-14 06:20 | 0 | |
![[SND]](/icons/sound2.gif) | Mejbi_Bejbi_Instasamka_diss.mp3 | 2022-08-14 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY13.mp3 | 2022-08-14 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY12.mp3 | 2022-08-14 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY11.mp3 | 2022-08-14 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY10.mp3 | 2022-08-14 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | VIN1140ZR.mp3 | 2022-08-14 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | yt5s.com - Can You Feel My Heart, but slowed and pitched down 0.75x (128 kbps).mp3 | 2022-08-14 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | punta.mp3 | 2022-08-14 06:13 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY9.mp3 | 2022-08-14 06:12 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY8.mp3 | 2022-08-14 06:12 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY7.mp3 | 2022-08-14 06:12 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY6.mp3 | 2022-08-14 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | closer.mp3 | 2022-08-14 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | Reckless.mp3 | 2022-08-14 06:11 | 1.2M | |
![[SND]](/icons/sound2.gif) | GINOFY5.mp3 | 2022-08-14 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY4.mp3 | 2022-08-14 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY3.mp3 | 2022-08-14 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY2.mp3 | 2022-08-14 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | GINOFY1.mp3 | 2022-08-14 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | ardiankmk.mp3 | 2022-08-14 06:05 | 0 | |
![[SND]](/icons/sound2.gif) | Vp10.mp3 | 2022-08-14 06:01 | 440K | |
![[SND]](/icons/sound2.gif) | รวมเพลงแดนซ์มันส์ๆ 2022 เบสแน่นๆ (วอเอะๆๆ X Come On ) ฟังยาวๆ คัดมาแล้ว!! BY DJ PONG REMIX.mp3 | 2022-08-14 06:00 | 0 | |
![[SND]](/icons/sound2.gif) | Arcade.mp3 | 2022-08-14 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | YWNW.mp3 | 2022-08-14 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | bandengke.mp3 | 2022-08-14 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | Virgoun ft. Audy - Selamat (Selamat Tinggal) (Lirik).mp3 | 2022-08-14 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | James Arthur - Can I Be Him (speed up version).mp3 | 2022-08-14 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | did i stutter_ __$p3d up r3verb.mp3 | 2022-08-14 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | cartel.mp3 | 2022-08-14 05:51 | 924K | |
![[SND]](/icons/sound2.gif) | Harry Styles - As It Was (Official Video).mp3 | 2022-08-14 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | _Strong_ - one direction sped up.mp3 | 2022-08-14 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | hklk.mp3 | 2022-08-14 05:50 | 2.8M | |
![[SND]](/icons/sound2.gif) | b249ec94c7fee47b8cf9da8400d4a224 (online-audio-converter.com).mp3 | 2022-08-14 05:50 | 0 | |
![[SND]](/icons/sound2.gif) | Vip9.mp3 | 2022-08-14 05:50 | 1.4M | |
![[SND]](/icons/sound2.gif) | amal.mp3 | 2022-08-14 05:49 | 0 | |
![[SND]](/icons/sound2.gif) | xRilts20.mp3 | 2022-08-14 05:47 | 0 | |
![[SND]](/icons/sound2.gif) | xRilts20.mp3.mp3 | 2022-08-14 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | iingatanka.mp3 | 2022-08-14 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | velvet.mp3 | 2022-08-14 05:38 | 0 | |
![[SND]](/icons/sound2.gif) | sadvibes.mp3 | 2022-08-14 05:37 | 2.1M | |
![[SND]](/icons/sound2.gif) | genjer.mp3 | 2022-08-14 05:36 | 2.0M | |
![[SND]](/icons/sound2.gif) | bomz.mp3 | 2022-08-14 05:35 | 0 | |
![[SND]](/icons/sound2.gif) | ingatka.mp3 | 2022-08-14 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | tiktod.mp3 | 2022-08-14 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | MLD1.mp3 | 2022-08-14 05:30 | 0 | |
![[SND]](/icons/sound2.gif) | james17.mp3 | 2022-08-14 05:29 | 0 | |
![[SND]](/icons/sound2.gif) | LLLL.mp3 | 2022-08-14 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | December.mp3 | 2022-08-14 05:27 | 1.5M | |
![[SND]](/icons/sound2.gif) | picture.mp3 | 2022-08-14 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | hengkel.mp3 | 2022-08-14 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | message.mp3 | 2022-08-14 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | test.mp3 | 2022-08-14 05:20 | 0 | |
![[SND]](/icons/sound2.gif) | GENJER-GENJER.mp3 | 2022-08-14 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | Mate2.mp3 | 2022-08-14 05:09 | 2.0M | |
![[SND]](/icons/sound2.gif) | sayang.mp3 | 2022-08-14 05:05 | 636K | |
![[SND]](/icons/sound2.gif) | Serebro - Мало Тебя (BassnPanda Remix) HAPPY HARDCORE NIGHTCORE (mp3-2020.com).mp3 | 2022-08-14 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | sade.mp3 | 2022-08-14 05:04 | 0 | |
![[SND]](/icons/sound2.gif) | CALLME.mp3 | 2022-08-14 05:04 | 0 | |
![[VID]](/icons/movie.gif) | b249ec94c7fee47b8cf9da8400d4a224.mp4 | 2022-08-14 05:02 | 0 | |
![[SND]](/icons/sound2.gif) | james21.mp3 | 2022-08-14 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Athena.mp3 | 2022-08-14 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | DANGANRONPA OST_ -2-18- Goodbye, Despair Academy.mp3 | 2022-08-14 04:42 | 0 | |
![[SND]](/icons/sound2.gif) | CJWhoopty.mp3 | 2022-08-14 04:34 | 0 | |
![[SND]](/icons/sound2.gif) | kands1.mp3 | 2022-08-14 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | feelgood.mp3 | 2022-08-14 04:21 | 0 | |
![[SND]](/icons/sound2.gif) | sodagrap!.mp3 | 2022-08-14 04:19 | 0 | |
![[SND]](/icons/sound2.gif) | YuuKii.mp3 | 2022-08-14 04:16 | 0 | |
![[SND]](/icons/sound2.gif) | Le4.mp3 | 2022-08-14 04:16 | 0 | |
![[SND]](/icons/sound2.gif) | Le3.mp3 | 2022-08-14 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | Le2.mp3 | 2022-08-14 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | yt5s.com - mood lofi - ft. salem ilese (Yagih Mael)(Lyrics) (128 kbps).mp3 | 2022-08-14 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | Le1.mp3 | 2022-08-14 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | Modpack Keni-SAMP V2!!! Support SAMP Beta!!.mp3 | 2022-08-14 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | Higa1.mp3 | 2022-08-14 04:13 | 1.2M | |
![[SND]](/icons/sound2.gif) | bek9.mp3 | 2022-08-14 04:06 | 0 | |
![[SND]](/icons/sound2.gif) | bek3.mp3 | 2022-08-14 04:04 | 4.8M | |
![[SND]](/icons/sound2.gif) | play1.mp3 | 2022-08-14 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | 2333614955.mp3 | 2022-08-14 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | a2.mp3 | 2022-08-14 03:57 | 3.5M | |
![[SND]](/icons/sound2.gif) | Jamur.mp3 | 2022-08-14 03:56 | 2.0M | |
![[SND]](/icons/sound2.gif) | frans33.mp3 | 2022-08-14 03:55 | 0 | |
![[SND]](/icons/sound2.gif) | Enyetdj.mp3 | 2022-08-14 03:55 | 0 | |
![[SND]](/icons/sound2.gif) | dejee1.mp3 | 2022-08-14 03:53 | 0 | |
![[SND]](/icons/sound2.gif) | a1.mp3 | 2022-08-14 03:53 | 3.2M | |
![[SND]](/icons/sound2.gif) | dinginbet.mp3 | 2022-08-14 03:51 | 0 | |
![[SND]](/icons/sound2.gif) | mp30.mp3 | 2022-08-14 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | 30.mp3 | 2022-08-14 03:50 | 88K | |
![[SND]](/icons/sound2.gif) | K_DA - 'POP_STARS' LYRICS (ft (G)I-DLE, Madison Beer, Jaira Burns) (Color Coded Eng_Rom_Han_가사).mp3 | 2022-08-14 03:49 | 0 | |
![[SND]](/icons/sound2.gif) | K_DA - POP_STARS (ft. Madison Beer, (G)I-DLE, Jaira Burns) _ Music Video - League of Legends.mp3 | 2022-08-14 03:42 | 0 | |
![[SND]](/icons/sound2.gif) | KINGDOM(킹덤) '단심가' MV (128 kbps).mp3 | 2022-08-14 03:36 | 0 | |
![[SND]](/icons/sound2.gif) | rahmanh1.mp3 | 2022-08-14 03:27 | 0 | |
![[SND]](/icons/sound2.gif) | SBS.mp3 | 2022-08-14 03:24 | 0 | |
![[SND]](/icons/sound2.gif) | tian.mp3 | 2022-08-14 03:24 | 1.1M | |
![[SND]](/icons/sound2.gif) | X2Download.com - THE TOYS - เมะ (kiss by kiss) [Official Lyrics] (128 kbps).mp3 | 2022-08-14 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | KUBURAN.mp3 | 2022-08-14 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | heart.mp3 | 2022-08-14 03:17 | 0 | |
![[SND]](/icons/sound2.gif) | mp98.mp3 | 2022-08-14 03:16 | 0 | |
![[SND]](/icons/sound2.gif) | Chocolate_factory_-_Heartbreak_Anniversary_(giveon_reggae_cover)(MP3_160K)_1.mp3 | 2022-08-14 03:15 | 0 | |
![[SND]](/icons/sound2.gif) | mp99.mp3 | 2022-08-14 03:14 | 0 | |
![[SND]](/icons/sound2.gif) | story wa 30 detik _ hari ini selamat ulang tahun untuk diri sendiri.mp3 | 2022-08-14 03:14 | 540K | |
![[SND]](/icons/sound2.gif) | djraher4.mp3 | 2022-08-14 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | djkomang.mp3 | 2022-08-14 03:07 | 3.9M | |
![[SND]](/icons/sound2.gif) | djraher3.mp3 | 2022-08-14 03:06 | 0 | |
![[SND]](/icons/sound2.gif) | Kavuda.mp3 | 2022-08-14 02:59 | 0 | |
![[SND]](/icons/sound2.gif) | Athmavile.mp3 | 2022-08-14 02:59 | 0 | |
![[SND]](/icons/sound2.gif) | Shikkari.mp3 | 2022-08-14 02:59 | 0 | |
![[SND]](/icons/sound2.gif) | Zara.mp3 | 2022-08-14 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ranja.mp3 | 2022-08-14 02:57 | 0 | |
![[SND]](/icons/sound2.gif) | Let.mp3 | 2022-08-14 02:57 | 3.9M | |
![[SND]](/icons/sound2.gif) | mp21.mp3 | 2022-08-14 02:56 | 3.4M | |
![[SND]](/icons/sound2.gif) | 21.mp3 | 2022-08-14 02:55 | 88K | |
![[SND]](/icons/sound2.gif) | mp18.mp3 | 2022-08-14 02:54 | 5.7M | |
![[SND]](/icons/sound2.gif) | 19.mp3 | 2022-08-14 02:53 | 1.2M | |
![[SND]](/icons/sound2.gif) | Habibi.mp3 | 2022-08-14 02:53 | 0 | |
![[SND]](/icons/sound2.gif) | mp10.mp3 | 2022-08-14 02:52 | 5.1M | |
![[SND]](/icons/sound2.gif) | 16.mp3 | 2022-08-14 02:51 | 88K | |
![[SND]](/icons/sound2.gif) | mmk.mp3 | 2022-08-14 02:51 | 1.8M | |
![[SND]](/icons/sound2.gif) | Cent1.mp3 | 2022-08-14 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | asu.mp3 | 2022-08-14 02:51 | 1.5M | |
![[SND]](/icons/sound2.gif) | mp12.mp3 | 2022-08-14 02:51 | 3.7M | |
![[SND]](/icons/sound2.gif) | 13.mp3 | 2022-08-14 02:49 | 4.1M | |
![[SND]](/icons/sound2.gif) | mp14.mp3 | 2022-08-14 02:48 | 268K | |
![[SND]](/icons/sound2.gif) | mp15.mp3 | 2022-08-14 02:47 | 3.6M | |
![[SND]](/icons/sound2.gif) | mp16.mp3 | 2022-08-14 02:46 | 5.4M | |
![[SND]](/icons/sound2.gif) | mp17.mp3 | 2022-08-14 02:45 | 236K | |
![[SND]](/icons/sound2.gif) | INDO1945.mp3 | 2022-08-14 02:45 | 0 | |
![[SND]](/icons/sound2.gif) | Bocil28.mp3 | 2022-08-14 02:39 | 0 | |
![[SND]](/icons/sound2.gif) | firstbeatwip.mp3 | 2022-08-14 02:37 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije4.mp3 | 2022-08-14 02:36 | 3.3M | |
![[SND]](/icons/sound2.gif) | rap.mp3 | 2022-08-14 02:33 | 2.7M | |
![[SND]](/icons/sound2.gif) | pler2.mp3 | 2022-08-14 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | aaaa.mp3 | 2022-08-14 02:24 | 3.0M | |
![[SND]](/icons/sound2.gif) | untukapa.mp3 | 2022-08-14 02:24 | 0 | |
![[SND]](/icons/sound2.gif) | rap1.mp3 | 2022-08-14 02:18 | 2.0M | |
![[SND]](/icons/sound2.gif) | mp100.mp3 | 2022-08-14 02:18 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660442087212.mp3 | 2022-08-14 02:16 | 0 | |
![[SND]](/icons/sound2.gif) | Krovostok_-_Biografiya_55628538.mp3 | 2022-08-14 02:14 | 0 | |
![[SND]](/icons/sound2.gif) | secukupnya.mp3 | 2022-08-14 02:13 | 0 | |
![[SND]](/icons/sound2.gif) | Wasky8.mp3 | 2022-08-14 02:12 | 3.5M | |
![[SND]](/icons/sound2.gif) | salmonela.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | W.mp3 | 2022-08-14 02:10 | 3.5M | |
![[SND]](/icons/sound2.gif) | G.mp3 | 2022-08-14 02:10 | 2.1M | |
![[SND]](/icons/sound2.gif) | WALTER.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | S.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | TOKYO.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | U.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | ASEDE.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | B.mp3 | 2022-08-14 02:10 | 552K | |
![[SND]](/icons/sound2.gif) | Wasky9.mp3 | 2022-08-14 02:10 | 0 | |
![[SND]](/icons/sound2.gif) | pler4.mp3 | 2022-08-14 02:09 | 0 | |
![[SND]](/icons/sound2.gif) | nanda.mp3 | 2022-08-14 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | Wasky11.mp3 | 2022-08-14 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | mh.mp3 | 2022-08-14 02:06 | 0 | |
![[SND]](/icons/sound2.gif) | bv.mp3 | 2022-08-14 01:58 | 160K | |
![[SND]](/icons/sound2.gif) | Alex.mp3 | 2022-08-14 01:54 | 4.3M | |
![[SND]](/icons/sound2.gif) | Wasky10.mp3 | 2022-08-14 01:53 | 2.3M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Nhạc Trẻ Remix 2022 Hay Nhất Hiện Nay NONSTOP 2022 Bass Cực MạnhViệt Mix Dj Nonstop 2022 Vinahouse.mp3 | 2022-08-14 01:52 | 0 | |
![[VID]](/icons/movie.gif) | lv_7115088159393811714_20220814084520.mp4 | 2022-08-14 01:46 | 0 | |
![[SND]](/icons/sound2.gif) | dj.mp3 | 2022-08-14 01:41 | 0 | |
![[SND]](/icons/sound2.gif) | Disturbed • The Sound of Silence 000.mp3 | 2022-08-14 01:07 | 2.0M | |
![[SND]](/icons/sound2.gif) | bgndl22.mp3 | 2022-08-14 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | clan1.mp3 | 2022-08-14 00:59 | 0 | |
![[SND]](/icons/sound2.gif) | Cali.mp3 | 2022-08-14 00:57 | 2.2M | |
![[SND]](/icons/sound2.gif) | Mad.mp3 | 2022-08-14 00:47 | 0 | |
![[SND]](/icons/sound2.gif) | прклетыи фаил дело в шляпе нюхаи бебру.m4a | 2022-08-14 00:41 | 0 | |
![[SND]](/icons/sound2.gif) | очень страшная проклетая музыка я верю в чудеса слышу все голоса.m4a | 2022-08-14 00:39 | 0 | |
![[SND]](/icons/sound2.gif) | PvZ.mp3 | 2022-08-14 00:37 | 0 | |
![[SND]](/icons/sound2.gif) | Random1.mp3 | 2022-08-14 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | short-success-sound-glockenspiel-treasure-video-game-6346.mp3 | 2022-08-14 00:29 | 0 | |
![[SND]](/icons/sound2.gif) | bgnll.mp3 | 2022-08-14 00:28 | 0 | |
![[SND]](/icons/sound2.gif) | страшныи ад.m4a | 2022-08-14 00:27 | 0 | |
![[SND]](/icons/sound2.gif) | страшно печальныи ад.m4a | 2022-08-14 00:27 | 0 | |
![[SND]](/icons/sound2.gif) | Placebo_-_Running_Up_That_Hill_(getmp3.pro).mp3 | 2022-08-14 00:27 | 5.9M | |
![[SND]](/icons/sound2.gif) | страшная музыка.m4a | 2022-08-14 00:26 | 3.5M | |
![[SND]](/icons/sound2.gif) | jaxtin.mp3 | 2022-08-14 00:25 | 0 | |
![[SND]](/icons/sound2.gif) | очень страшная музыка для вызывание духов.m4a | 2022-08-14 00:24 | 0 | |
![[SND]](/icons/sound2.gif) | Migos1.mp3 | 2022-08-14 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | crybabyy.mp3 | 2022-08-14 00:12 | 0 | |
![[SND]](/icons/sound2.gif) | Kyo1.mp3 | 2022-08-14 00:10 | 0 | |
![[SND]](/icons/sound2.gif) | rizqi.mp3 | 2022-08-14 00:05 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - Pragmatischer Vernichtungswahn Antisemitismus und Maslahat in der Islamischen Republik Iran.mp3 | 2022-08-14 00:01 | 0 | |
![[SND]](/icons/sound2.gif) | Sadabiz.mp3 | 2022-08-14 00:00 | 0 | |
![[SND]](/icons/sound2.gif) | _ quotSTAND BY ME quot Full Covered by amp .mp3 | 2022-08-13 23:58 | 0 | |
![[SND]](/icons/sound2.gif) | Da.mp3 | 2022-08-13 23:51 | 0 | |
![[SND]](/icons/sound2.gif) | bgndl.mp3 | 2022-08-13 23:51 | 0 | |
![[SND]](/icons/sound2.gif) | roses1.mp3 | 2022-08-13 23:49 | 3.5M | |
![[SND]](/icons/sound2.gif) | pesanterakhir.mp3 | 2022-08-13 23:46 | 0 | |
![[SND]](/icons/sound2.gif) | STAND-BY-ME-Full-Covered-by__duWnJ6nsz0.mp3 | 2022-08-13 23:46 | 0 | |
![[SND]](/icons/sound2.gif) | Dj dermaga biru.mp3 | 2022-08-13 23:43 | 0 | |
![[SND]](/icons/sound2.gif) | Koffee - Throne.mp3 | 2022-08-13 23:36 | 0 | |
![[SND]](/icons/sound2.gif) | Yea.mp3 | 2022-08-13 23:32 | 0 | |
![[SND]](/icons/sound2.gif) | pasalubong.mp3 | 2022-08-13 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | maybe.mp3 | 2022-08-13 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | someday.mp3 | 2022-08-13 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | malayo.mp3 | 2022-08-13 23:29 | 4.2M | |
![[SND]](/icons/sound2.gif) | Dio - Rainbow In The Dark - Medieval Style (Bardcore) (128 kbps).mp3 | 2022-08-13 23:27 | 0 | |
![[SND]](/icons/sound2.gif) | windah9.mp3 | 2022-08-13 23:15 | 0 | |
![[SND]](/icons/sound2.gif) | data.mp3 | 2022-08-13 23:09 | 0 | |
![[SND]](/icons/sound2.gif) | russian-low-quality-phonk.mp3 | 2022-08-13 23:08 | 0 | |
![[SND]](/icons/sound2.gif) | 01. Earth, Wind & Fire with The Emotions - Boogie Wonderland.mp3 | 2022-08-13 23:05 | 0 | |
![[SND]](/icons/sound2.gif) | cc.mp3 | 2022-08-13 23:04 | 3.2M | |
![[SND]](/icons/sound2.gif) | Singing Every Song RLN.mp3 | 2022-08-13 23:04 | 0 | |
![[SND]](/icons/sound2.gif) | Swinging At Shadows RLN.mp3 | 2022-08-13 23:03 | 0 | |
![[SND]](/icons/sound2.gif) | So Good RLN.mp3 | 2022-08-13 23:03 | 0 | |
![[SND]](/icons/sound2.gif) | My Lady Of Water And Fire RLN.mp3 | 2022-08-13 23:03 | 0 | |
![[SND]](/icons/sound2.gif) | I Will Not Be Broken RLN.mp3 | 2022-08-13 23:02 | 0 | |
![[SND]](/icons/sound2.gif) | Maybe Today RLN.mp3 | 2022-08-13 23:02 | 0 | |
![[SND]](/icons/sound2.gif) | JACK_DANIELS_-_BLOODS_ATTACK_-_TRA_(getmp3.pro).mp3 | 2022-08-13 23:02 | 0 | |
![[SND]](/icons/sound2.gif) | Show You RLN.mp3 | 2022-08-13 23:01 | 0 | |
![[SND]](/icons/sound2.gif) | Time RLN.mp3 | 2022-08-13 23:01 | 0 | |
![[SND]](/icons/sound2.gif) | Never Fall In Love RLN.mp3 | 2022-08-13 23:01 | 0 | |
![[SND]](/icons/sound2.gif) | RdV9.mp3 | 2022-08-13 22:59 | 33M | |
![[SND]](/icons/sound2.gif) | RdV2.mp3 | 2022-08-13 22:58 | 2.9M | |
![[SND]](/icons/sound2.gif) | RdV1.mp3 | 2022-08-13 22:57 | 4.0M | |
![[SND]](/icons/sound2.gif) | Jhon13.mp3 | 2022-08-13 22:43 | 0 | |
![[SND]](/icons/sound2.gif) | ShakoPhobia Shake Ya Head Zool Power Final.mp3 | 2022-08-13 22:35 | 0 | |
![[SND]](/icons/sound2.gif) | Nenad1.mp3 | 2022-08-13 22:30 | 0 | |
![[SND]](/icons/sound2.gif) | Cover.mp3 | 2022-08-13 22:23 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Pakistan National Anthem (Instrumental)-A8ZxRKcRJgw-160k-1660240822676.mp3 | 2022-08-13 22:09 | 0 | |
![[SND]](/icons/sound2.gif) | bjarla-obryad-sejjd-musmorecom_yRzU3i79.mp3 | 2022-08-13 22:09 | 0 | |
![[SND]](/icons/sound2.gif) | fada.mp3 | 2022-08-13 22:03 | 0 | |
![[SND]](/icons/sound2.gif) | poki.mp3 | 2022-08-13 21:52 | 0 | |
![[SND]](/icons/sound2.gif) | zapahduhov.mp3 | 2022-08-13 21:43 | 0 | |
![[SND]](/icons/sound2.gif) | [MP3DOWNLOAD.TO] The Ocean Waves Original Soundtrack - First Impression-320k.mp3 | 2022-08-13 21:43 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije5.mp3 | 2022-08-13 21:42 | 1.9M | |
![[SND]](/icons/sound2.gif) | Dewa 19 (Feat. Ari Lasso) - Arjuna Mencari Cinta Sounds From The Corner Live 19.mp3 | 2022-08-13 21:39 | 0 | |
![[SND]](/icons/sound2.gif) | PLA.mp3 | 2022-08-13 21:36 | 0 | |
![[VID]](/icons/movie.gif) | Gaara1.mp4 | 2022-08-13 21:32 | 0 | |
![[SND]](/icons/sound2.gif) | Poylow_BAUWZ_-_Hate_You_feat_Nito-Onna_NCS_Release_320_kbps_73561800 (1).mp3 | 2022-08-13 21:32 | 0 | |
![[SND]](/icons/sound2.gif) | Gazaliy3.mp3 | 2022-08-13 21:30 | 0 | |
![[SND]](/icons/sound2.gif) | Gazaliy1.mp3 | 2022-08-13 21:29 | 0 | |
![[SND]](/icons/sound2.gif) | Gaara1.mp3 | 2022-08-13 21:27 | 0 | |
![[SND]](/icons/sound2.gif) | MAK.mp3 | 2022-08-13 21:18 | 0 | |
![[SND]](/icons/sound2.gif) | Dixie1.mp3 | 2022-08-13 20:57 | 0 | |
![[SND]](/icons/sound2.gif) | meq.mp3 | 2022-08-13 20:48 | 0 | |
![[SND]](/icons/sound2.gif) | IFTK0.mp3 | 2022-08-13 20:45 | 0 | |
![[SND]](/icons/sound2.gif) | lana_del_rei_x_coolio_-_remix_sickick_(muzrecord.com).mp3 | 2022-08-13 20:44 | 6.4M | |
![[SND]](/icons/sound2.gif) | cave.mp3 | 2022-08-13 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Elisa_Lost_into_the_Night_(Initial_D_1st_Stage _D_Selection 2_)_(www.lightaudio.ru).mp3 | 2022-08-13 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | Tama3.mp3 | 2022-08-13 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | santuy.mp3 | 2022-08-13 20:32 | 2.7M | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-14 at 1.29.27 AM.mp3 | 2022-08-13 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | AudioCutter_Голос 012.m4a | 2022-08-13 20:30 | 700K | |
![[SND]](/icons/sound2.gif) | Elisa - Lost Into The Night (dizer.net).mp3 | 2022-08-13 20:29 | 0 | |
![[SND]](/icons/sound2.gif) | Dance_With_The_Dead_Kickstart_My_Heart_Remix_67620761.mp3 | 2022-08-13 20:27 | 0 | |
![[SND]](/icons/sound2.gif) | russkij_razmer_angel_dna_skuzmin_remix_(muzebra.net).mp3 | 2022-08-13 20:19 | 0 | |
![[SND]](/icons/sound2.gif) | Naina Bawre (Tishnagi) - Amit Mishra-(HeroMaza).mp3 | 2022-08-13 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | Simaga feat. Shot — На связи (www.lightaudio.ru).mp3 | 2022-08-13 20:17 | 0 | |
![[SND]](/icons/sound2.gif) | Kolja Goldstein - Ambassador.mp3 | 2022-08-13 20:14 | 0 | |
![[SND]](/icons/sound2.gif) | Fraulein - Victor Wood (Lyrics) 🎶.mp3 | 2022-08-13 20:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ama namin [trapremix by sickbeats].mp3 | 2022-08-13 20:12 | 0 | |
![[SND]](/icons/sound2.gif) | Jayson In Town - Idana.mp3 | 2022-08-13 20:12 | 0 | |
![[SND]](/icons/sound2.gif) | DJ PAK WONG VONG STYLE THAILAND.mp3 | 2022-08-13 20:11 | 0 | |
![[SND]](/icons/sound2.gif) | Amanamin2.mp3 | 2022-08-13 20:06 | 0 | |
![[SND]](/icons/sound2.gif) | Budotsremix2.mp3 | 2022-08-13 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | Fraulein.mp3 | 2022-08-13 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | wudbw2.mp3 | 2022-08-13 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | BMF X C14 FT SPARTA - BENDO [PROD BY DJ SMZ].mp3 | 2022-08-13 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | Idana.mp3 | 2022-08-13 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | aryak45.mp3 | 2022-08-13 20:02 | 0 | |
![[SND]](/icons/sound2.gif) | DJ BURN FULL BEAT VIRAL TIKTOK TERBARU DJ ASIA REMIX.mp3 | 2022-08-13 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Grove.mp3 | 2022-08-13 20:00 | 0 | |
![[SND]](/icons/sound2.gif) | alarm.mp3 | 2022-08-13 19:58 | 76K | |
![[SND]](/icons/sound2.gif) | firaz-shatohin-uhodit-rota-soldat-remix(mp3gid.me).mp3 | 2022-08-13 19:56 | 0 | |
![[SND]](/icons/sound2.gif) | Sedihcukasli.mp3 | 2022-08-13 19:56 | 0 | |
![[SND]](/icons/sound2.gif) | skinny-pete-zg-movement.mp3 | 2022-08-13 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | adamsick.mp3 | 2022-08-13 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | reksio_wiertara_145bpm.mp3 | 2022-08-13 19:46 | 0 | |
![[SND]](/icons/sound2.gif) | Anees - Sun and Moon Remix (Lyrics) ft. JROA.mp3 | 2022-08-13 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | _STING_the_seeen_Mp3.mp3 | 2022-08-13 19:41 | 0 | |
![[SND]](/icons/sound2.gif) | _Sting____vybz_Kartel_Dis_Song_MP3.mp3 | 2022-08-13 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | RAH Band - Messages from the Stars (minus) +0 semitone.mp3 | 2022-08-13 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | Alyss - Pyramid.mp3 | 2022-08-13 19:34 | 0 | |
![[SND]](/icons/sound2.gif) | Recording.mp3 | 2022-08-13 19:32 | 0 | |
![[SND]](/icons/sound2.gif) | oni_-_Vishnjovaya_semjorka_66036477.mp3 | 2022-08-13 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | UCRPWALWALAN.mp3 | 2022-08-13 19:20 | 0 | |
![[SND]](/icons/sound2.gif) | JJJJDJ.mp3 | 2022-08-13 19:19 | 1.9M | |
![[SND]](/icons/sound2.gif) | momok.mp3 | 2022-08-13 19:19 | 2.5M | |
![[SND]](/icons/sound2.gif) | Vocaroo 13 Aug 2022 21_14_46 GMT+0200 18YcLIuPjLXJ.mp3 | 2022-08-13 19:16 | 0 | |
![[SND]](/icons/sound2.gif) | Cubee1.mp3 | 2022-08-13 19:10 | 0 | |
![[SND]](/icons/sound2.gif) | JairoSinclair.mp3 | 2022-08-13 19:10 | 0 | |
![[SND]](/icons/sound2.gif) | Achuz1.mp3 | 2022-08-13 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | tinder.mp3 | 2022-08-13 19:00 | 2.2M | |
![[SND]](/icons/sound2.gif) | ck2.mp3.mp3 | 2022-08-13 18:46 | 0 | |
![[SND]](/icons/sound2.gif) | 1530786636_miyagi-captain.mp3 | 2022-08-13 18:36 | 0 | |
![[SND]](/icons/sound2.gif) | Instakim_com_tok.mp3 | 2022-08-13 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | mlkop1.mp3 | 2022-08-13 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | Vladimir Shaikin (_Blacksmith_) — It's Showtime! (Elias' Theme) (www.lightaudio.ru).mp3 | 2022-08-13 18:26 | 0 | |
![[SND]](/icons/sound2.gif) | Malaak_op.mp3 | 2022-08-13 18:26 | 0 | |
![[SND]](/icons/sound2.gif) | ck1.mp3.mp3 | 2022-08-13 18:25 | 0 | |
![[SND]](/icons/sound2.gif) | Psyco-M - قرن الشيطان.mp3 | 2022-08-13 18:23 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka_love.mp3 | 2022-08-13 18:23 | 0 | |
![[SND]](/icons/sound2.gif) | инстасамка.mp3 | 2022-08-13 18:16 | 0 | |
![[SND]](/icons/sound2.gif) | Viktor_Cojj_-_Gruppa_krovi_47828908.mp3 | 2022-08-13 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | one50.mp3 | 2022-08-13 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | ck.mp3.mp3 | 2022-08-13 18:06 | 888K | |
![[SND]](/icons/sound2.gif) | YKC2.mp3 | 2022-08-13 18:06 | 0 | |
![[SND]](/icons/sound2.gif) | cube2.mp3 | 2022-08-13 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | Rae.mp3 | 2022-08-13 18:01 | 3.4M | |
![[SND]](/icons/sound2.gif) | cube1.mp3 | 2022-08-13 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | Gor_-_Dorogu_molodym_Prod_by_Karimbeatz_72998822.mp3 | 2022-08-13 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | Tadoww.mp3 | 2022-08-13 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi_Andy_Panda_-_Kassandra_Kosandra_68417287.mp3 | 2022-08-13 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ojo.mp3 | 2022-08-13 17:50 | 0 | |
![[SND]](/icons/sound2.gif) | the-limba-oni-nazyvayut-menya-boss-mp3.mp3 | 2022-08-13 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | keii.mp3 | 2022-08-13 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | Amber_-_Energy.mp3 | 2022-08-13 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | boma.mp3 | 2022-08-13 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | Tadow.mp3 | 2022-08-13 17:33 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Yeni Inka ft Farel Prayoga Joko TIngkir Ngombe Dawet Official Music Video ANEKA SAFARI.mp3 | 2022-08-13 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | hm.mp3 | 2022-08-13 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | ziya21.mp3 | 2022-08-13 17:22 | 0 | |
![[SND]](/icons/sound2.gif) | situation log updated xenophobe.mp3 | 2022-08-13 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - MERINDU LAGI YOVIE AND NUNO LIRIK .mp3 | 2022-08-13 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | lagugg1.mp3 | 2022-08-13 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | Baumwolle-Raffael-A-Speechelo.mp3 | 2022-08-13 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | 7. 장난스런 키스.mp3 | 2022-08-13 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije7776.mp3 | 2022-08-13 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | BGM Paris.mp3 | 2022-08-13 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije887.mp3 | 2022-08-13 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | 01. スーパーウルトラハイパーミラクルロマンチック.mp3 | 2022-08-13 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | Arut, Big Baby Tape - VLAGA.mp3 | 2022-08-13 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | 01. ambiguous.mp3 | 2022-08-13 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | Joji - Glimpse of Us (Lyrics).mp3 | 2022-08-13 17:05 | 3.6M | |
![[SND]](/icons/sound2.gif) | A$AP Rocky - Lord Pretty Flacko Jodye 2 (LPFJ2).mp3 | 2022-08-13 17:05 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN_-_Novyjj_Merin_66404393.mp3 | 2022-08-13 17:05 | 0 | |
![[SND]](/icons/sound2.gif) | 89.mp3 | 2022-08-13 17:04 | 0 | |
![[SND]](/icons/sound2.gif) | 5.mp3 | 2022-08-13 17:04 | 1.1M | |
![[SND]](/icons/sound2.gif) | DGK5.mp3 | 2022-08-13 16:56 | 2.0M | |
![[SND]](/icons/sound2.gif) | Vijay.mp3 | 2022-08-13 16:55 | 1.1M | |
![[SND]](/icons/sound2.gif) | Ghostemane - Mercury.mp3 | 2022-08-13 16:54 | 2.9M | |
![[SND]](/icons/sound2.gif) | SAMBLACK - ไม่เคยรักกัน ft. PUNYARB (Official Lyrics Video).mp3 | 2022-08-13 16:50 | 2.3M | |
![[SND]](/icons/sound2.gif) | เธอเด็ด (feat. OHOTDAD).mp3 | 2022-08-13 16:50 | 0 | |
![[SND]](/icons/sound2.gif) | Ck.mp3 | 2022-08-13 16:48 | 2.8M | |
![[SND]](/icons/sound2.gif) | DJ BOOMA BOOMA YEE TIK TOK REMIX TERBARU 2021 (DJ IMUT REMIX).mp3 | 2022-08-13 16:48 | 352K | |
![[SND]](/icons/sound2.gif) | E.mp3 | 2022-08-13 16:46 | 4.1M | |
![[SND]](/icons/sound2.gif) | Ra.mp3 | 2022-08-13 16:44 | 3.4M | |
![[SND]](/icons/sound2.gif) | Thalu.mp3 | 2022-08-13 16:44 | 0 | |
![[SND]](/icons/sound2.gif) | Y.mp3 | 2022-08-13 16:42 | 3.3M | |
![[SND]](/icons/sound2.gif) | titan.mp3.mp3 | 2022-08-13 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | Forrozão Astral - Dança do Elicopo(MP3_128K).mp3 | 2022-08-13 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220720-WA0009.mp3 | 2022-08-13 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | KONG.mp3 | 2022-08-13 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | MGRP LOADING SCREEN , V2 , 2K21 EDITION.mp3 | 2022-08-13 16:40 | 0 | |
![[SND]](/icons/sound2.gif) | Ulol.mp3 | 2022-08-13 16:38 | 0 | |
![[SND]](/icons/sound2.gif) | Raid - FUCK OFF II_كفاحي - instrumental(MP3_160K).mp3 | 2022-08-13 16:34 | 0 | |
![[SND]](/icons/sound2.gif) | 1-5.mp3 | 2022-08-13 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fire.mp3 | 2022-08-13 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | MOSLIM12.mp3 | 2022-08-13 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | carl5.mp3 | 2022-08-13 16:30 | 0 | |
![[SND]](/icons/sound2.gif) | carl4.mp3 | 2022-08-13 16:30 | 0 | |
![[SND]](/icons/sound2.gif) | carl3.mp3 | 2022-08-13 16:30 | 0 | |
![[SND]](/icons/sound2.gif) | carl2.mp3 | 2022-08-13 16:23 | 3.7M | |
![[SND]](/icons/sound2.gif) | flare.mp3 | 2022-08-13 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | Carl1.mp3 | 2022-08-13 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | wo.mp3 | 2022-08-13 16:21 | 0 | |
![[SND]](/icons/sound2.gif) | badgirllllll05_20220813_3.mp3 | 2022-08-13 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | ---------- - --_---- ---- ---------- ---- (----------) [------------ _ ------------](MP3_128K).mp3 | 2022-08-13 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | COMBI.mp3 | 2022-08-13 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | fire1.mp3 | 2022-08-13 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | fire2.mp3 | 2022-08-13 16:13 | 0 | |
![[SND]](/icons/sound2.gif) | santuycug1.mp3 | 2022-08-13 16:13 | 0 | |
![[SND]](/icons/sound2.gif) | anali1.mp3 | 2022-08-13 16:09 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Defamilita YK Song to My Friend Lyric.mp3 | 2022-08-13 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | payp0n.mp3 | 2022-08-13 16:06 | 788K | |
![[SND]](/icons/sound2.gif) | nama2.mp3 | 2022-08-13 16:02 | 0 | |
![[SND]](/icons/sound2.gif) | nama1.mp3 | 2022-08-13 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | jolen.mp3 | 2022-08-13 16:01 | 661K | |
![[SND]](/icons/sound2.gif) | Джизус - Запутанный День.mp3 | 2022-08-13 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | Tania.mp3 | 2022-08-13 16:00 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1657257212140.mp3 | 2022-08-13 15:59 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1653241824950.mp3 | 2022-08-13 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | na.mp3 | 2022-08-13 15:57 | 2.3M | |
![[SND]](/icons/sound2.gif) | Valt%.mp3 | 2022-08-13 15:57 | 0 | |
![[SND]](/icons/sound2.gif) | Goro - Дорогу молодым (Slowed Remix).mp3 | 2022-08-13 15:55 | 0 | |
![[VID]](/icons/movie.gif) | badgirllllll05_20220813_3.mp4 | 2022-08-13 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | PLOHOYPAREN, blago white - Благо Воронин плохой вор.mp3 | 2022-08-13 15:54 | 464K | |
![[SND]](/icons/sound2.gif) | shadowraze_-_showdown_73909739.mp3 | 2022-08-13 15:54 | 4.7M | |
![[SND]](/icons/sound2.gif) | maribercinta.mp3 | 2022-08-13 15:54 | 3.9M | |
![[SND]](/icons/sound2.gif) | shadowraze_-_astral_step_73249837.mp3 | 2022-08-13 15:54 | 0 | |
![[SND]](/icons/sound2.gif) | NIKI11.mp3 | 2022-08-13 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Different Heaven Safe And Sound NCS Release.mp3 | 2022-08-13 15:53 | 2.9M | |
![[SND]](/icons/sound2.gif) | Chernikovskaya_Hata_-_Belaya_noch_69755145.mp3 | 2022-08-13 15:52 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - VIRAL TIK TOK NI MERIANG DJANDRIHANTAKAN FT BY ENC DJ RIZKY GOKIELZ ENAKK KALII.mp3 | 2022-08-13 15:50 | 0 | |
![[SND]](/icons/sound2.gif) | The Zombie Song (Wolfychu Animation) (AvdioTrik.com).mp3 | 2022-08-13 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | PLER.mp3 | 2022-08-13 15:47 | 0 | |
![[SND]](/icons/sound2.gif) | Mbc1.mp3 | 2022-08-13 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | mmuli.mp3 | 2022-08-13 15:40 | 0 | |
![[SND]](/icons/sound2.gif) | Bi-2_-_CHernoe_solnce_(new.muzikavsem.org).mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | dhije1.mp3 | 2022-08-13 15:38 | 3.6M | |
![[SND]](/icons/sound2.gif) | PhaoH.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | Cho.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | BCCT.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | Minion.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | BTTL.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | Siuuu.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | Ghast1.mp3 | 2022-08-13 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | aoa.mp3 | 2022-08-13 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | chajj-vdvoem-den-rozhdenja.mp3 | 2022-08-13 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | Falk - vs. YINU.mp3 | 2022-08-13 15:33 | 0 | |
![[SND]](/icons/sound2.gif) | Nox Arcana - A Touch of Evil.mp3 | 2022-08-13 15:31 | 0 | |
![[SND]](/icons/sound2.gif) | Aisy.mp3 | 2022-08-13 15:30 | 0 | |
![[SND]](/icons/sound2.gif) | alvin.mp3 | 2022-08-13 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | Srp2.mp3 | 2022-08-13 15:27 | 308K | |
![[SND]](/icons/sound2.gif) | Sad.mp3 | 2022-08-13 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | lugowo3.mp3 | 2022-08-13 15:21 | 4.3M | |
![[SND]](/icons/sound2.gif) | seph1.mp3 | 2022-08-13 15:20 | 2.2M | |
![[SND]](/icons/sound2.gif) | erpe.mp3 | 2022-08-13 15:19 | 1.8M | |
![[SND]](/icons/sound2.gif) | NIKI - Strange Land (Live) Acoustic Sessions.mp3 | 2022-08-13 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | Olivia Rodrigo - drivers license (Official Video).mp3 | 2022-08-13 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | Ace_Attorney_-_Cross_Examination_Allegro_2001_(Gybka.com).mp3 | 2022-08-13 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | btr.mp3 | 2022-08-13 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | The Final Flash of Existence (SCP_ Secret Laboratory Main Theme).mp3 | 2022-08-13 15:15 | 548K | |
![[SND]](/icons/sound2.gif) | 7071033479907085062.mp3 | 2022-08-13 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | Ulligaddauttej.mp3 | 2022-08-13 15:11 | 0 | |
![[SND]](/icons/sound2.gif) | chill.mp3 | 2022-08-13 15:09 | 2.6M | |
![[SND]](/icons/sound2.gif) | WENARO_LXNER_-_Ljod_73215474.mp3 | 2022-08-13 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | MBC1.mp3 | 2022-08-13 15:01 | 0 | |
![[SND]](/icons/sound2.gif) | NOCOMMENT.mp3 | 2022-08-13 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | Djlugowo.mp3 | 2022-08-13 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | Isolateexe_-_Crystals_(musmore.com).mp3 | 2022-08-13 14:56 | 5.3M | |
![[SND]](/icons/sound2.gif) | AUD-20220813-WA0041.mp3 | 2022-08-13 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | Wasky4.mp3 | 2022-08-13 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - din bhar ki khabar news of the day hindi news india top news Bihar Politics Rahul dblive.mp3 | 2022-08-13 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | meomor.mp3 | 2022-08-13 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | Indila Love Story .mp3 | 2022-08-13 14:44 | 0 | |
![[SND]](/icons/sound2.gif) | Eminem2.mp3 | 2022-08-13 14:44 | 4.4M | |
![[SND]](/icons/sound2.gif) | pler3.mp3 | 2022-08-13 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | Floods (live) - Pantera.mp3 | 2022-08-13 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | hayun4.mp3 | 2022-08-13 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | Jennie5.mp3 | 2022-08-13 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | KNOCK.mp3 | 2022-08-13 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | djbasindir.mp3 | 2022-08-13 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | HOYO-MiX - Lithic Oath.mp3 | 2022-08-13 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | HOYO-MiX - On the Vast Earth.mp3 | 2022-08-13 14:34 | 0 | |
![[SND]](/icons/sound2.gif) | hayun2.mp3 | 2022-08-13 14:33 | 1.2M | |
![[SND]](/icons/sound2.gif) | vp2.mp3 | 2022-08-13 14:30 | 2.3M | |
![[SND]](/icons/sound2.gif) | vp1.mp3 | 2022-08-13 14:29 | 4.9M | |
![[SND]](/icons/sound2.gif) | KUMPULAN DJ FYP TIKTOK 2022 SOUND KANE JEDAG JEDUG FUL BAS TERBARU (129K).m4a | 2022-08-13 14:26 | 0 | |
![[SND]](/icons/sound2.gif) | hayun3.mp3 | 2022-08-13 14:26 | 0 | |
![[SND]](/icons/sound2.gif) | Biggie.mp3 | 2022-08-13 14:26 | 0 | |
![[SND]](/icons/sound2.gif) | Indila - Love Story _ lyrics terjemahan.mp3 | 2022-08-13 14:24 | 504K | |
![[VID]](/icons/movie.gif) | VID-20220812-WA0005.mp4 | 2022-08-13 14:24 | 0 | |
![[VID]](/icons/movie.gif) | 3d2a2638fa7fa2a3ab63489c8b953f42.mp4 | 2022-08-13 14:20 | 0 | |
![[SND]](/icons/sound2.gif) | bbhc1.mp3 | 2022-08-13 14:15 | 0 | |
![[SND]](/icons/sound2.gif) | Ch12.mp3 | 2022-08-13 14:15 | 0 | |
![[SND]](/icons/sound2.gif) | Ghost - Mary On A Cross (radio.lol).mp3 | 2022-08-13 14:13 | 0 | |
![[SND]](/icons/sound2.gif) | dobado.mp3 | 2022-08-13 14:12 | 0 | |
![[SND]](/icons/sound2.gif) | Chismiz.mp3 | 2022-08-13 14:11 | 60K | |
![[SND]](/icons/sound2.gif) | Макс Корж - 2 Типа Людей (megasongs.me).mp3 | 2022-08-13 14:09 | 0 | |
![[SND]](/icons/sound2.gif) | chi.mp3 | 2022-08-13 14:08 | 0 | |
![[SND]](/icons/sound2.gif) | God-is-a-Girl-Radio-Edit-Groove-Coverage_LmpIZceO6k0.mp3 | 2022-08-13 14:08 | 0 | |
![[SND]](/icons/sound2.gif) | sismis.mp3 | 2022-08-13 14:07 | 0 | |
![[SND]](/icons/sound2.gif) | DJ-ONE-DAY-X-LALALA-REMIX-TERBARU-FULL-BASS-DJ-Opus_EK5-xDqx4Eo.mp3 | 2022-08-13 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | DJ-CLOSE-YOUR-EYES-X-BANGUN-TIDUR-X-GAM-GAM-TEKI-TEKI-TIKTOK-VIRAL-REMIX-FULL-BASS-2022_5OMFlNtoVTs.mp3 | 2022-08-13 14:03 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ CAMPURAN VIRAL TIKTOK 2022 JEDAG JEDUG FULL BASS TERBARU.mp3 | 2022-08-13 14:01 | 2.0M | |
![[SND]](/icons/sound2.gif) | Wasky5.mp3 | 2022-08-13 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | Avenged-Sevenfold-Until-the-End-Official-Audio_0JGnGSQk6FA.mp3 | 2022-08-13 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | Wasky6.mp3 | 2022-08-13 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | DJ HAY TOCH SOUTH AFRICA & NIGERIA SOUND MIX.mp3 | 2022-08-13 13:58 | 22M | |
![[SND]](/icons/sound2.gif) | Wasky3.mp3 | 2022-08-13 13:58 | 2.8M | |
![[SND]](/icons/sound2.gif) | RAOF4.mp3 | 2022-08-13 13:58 | 7.8M | |
![[SND]](/icons/sound2.gif) | ArizonaRP.mp3 | 2022-08-13 13:57 | 4.1M | |
![[SND]](/icons/sound2.gif) | hayun1.mp3 | 2022-08-13 13:56 | 5.0M | |
![[SND]](/icons/sound2.gif) | vp6.mp3 | 2022-08-13 13:56 | 3.7M | |
![[SND]](/icons/sound2.gif) | 6.TOO BAD OUTRO.mp3 | 2022-08-13 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | 5.OHH LORD(SOLO)(R).mp3 | 2022-08-13 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | 4.NOW N EVER.mp3 | 2022-08-13 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | 3.TOO GANGSTAR.mp3 | 2022-08-13 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Tiara.mp3 | 2022-08-13 13:54 | 3.9M | |
![[SND]](/icons/sound2.gif) | 2.CLICK BANG BANG.mp3 | 2022-08-13 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | 1.CLICK INTRO.mp3 | 2022-08-13 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Rolex Entry Bgm | Rolex Entry Full Bgm | Lokiverse Bgm | [Download Link].mp3 | 2022-08-13 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | RAOF3.mp3 | 2022-08-13 13:52 | 0 | |
![[SND]](/icons/sound2.gif) | kaamelott-s01e01.mp3 | 2022-08-13 13:52 | 668K | |
![[SND]](/icons/sound2.gif) | vp5.mp3 | 2022-08-13 13:52 | 2.3M | |
![[SND]](/icons/sound2.gif) | vp4.mp3 | 2022-08-13 13:51 | 2.8M | |
![[SND]](/icons/sound2.gif) | RAOF1.mp3 | 2022-08-13 13:50 | 0 | |
![[SND]](/icons/sound2.gif) | WRT.mp3 | 2022-08-13 13:47 | 0 | |
![[SND]](/icons/sound2.gif) | vp3.mp3 | 2022-08-13 13:42 | 236K | |
![[SND]](/icons/sound2.gif) | wtd2.mp3 | 2022-08-13 13:41 | 0 | |
![[SND]](/icons/sound2.gif) | THRILL PILL - Миллионы.mp3 | 2022-08-13 13:38 | 0 | |
![[SND]](/icons/sound2.gif) | Макс Корж - 2 типа людей.mp3 | 2022-08-13 13:38 | 9.8M | |
![[SND]](/icons/sound2.gif) | Wish You Were Here.mp3 | 2022-08-13 13:38 | 6.2M | |
![[SND]](/icons/sound2.gif) | Vp8.mp3 | 2022-08-13 13:37 | 79K | |
![[SND]](/icons/sound2.gif) | Nuha-Bahrin-Naufal-Azrin-CASABLANCA-Lyric-Video_GQYQXfV6AVw.mp3 | 2022-08-13 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | ILS.mp3 | 2022-08-13 13:34 | 0 | |
![[SND]](/icons/sound2.gif) | Lokiverse Theme Video - Vikram _ Kamal Haasan _ ANIRUDH RAVICHANDER _ Lokesh Kanagaraj.mp3 | 2022-08-13 13:32 | 0 | |
![[SND]](/icons/sound2.gif) | wtd1.mp3 | 2022-08-13 13:28 | 384K | |
![[SND]](/icons/sound2.gif) | vmrpintro.mp3 | 2022-08-13 13:28 | 1.3M | |
![[SND]](/icons/sound2.gif) | TOBA5.mp3 | 2022-08-13 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Yama15.mp3 | 2022-08-13 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Bodiev_-_Karuseli_64743001.mp3 | 2022-08-13 13:26 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA3.mp3 | 2022-08-13 13:26 | 0 | |
![[SND]](/icons/sound2.gif) | alox.mp3 | 2022-08-13 13:26 | 0 | |
![[SND]](/icons/sound2.gif) | hey,thats pretty good..mp3 | 2022-08-13 13:25 | 0 | |
![[SND]](/icons/sound2.gif) | kanankiri.mp3 | 2022-08-13 13:25 | 1.7M | |
![[SND]](/icons/sound2.gif) | bgm2vmrp.mp3 | 2022-08-13 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - REMIX KOPLO DOTA Basshunter x Milos x Dimitri.mp3 | 2022-08-13 13:23 | 1.8M | |
![[SND]](/icons/sound2.gif) | KADAM KADAM.mp3 | 2022-08-13 13:23 | 2.6M | |
![[SND]](/icons/sound2.gif) | san.mp3 | 2022-08-13 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | KADAM KADAM BADHAYE JA _ A TRIBUTE TO NETAJI SUBHASH CHANDRA BOSE.mp3 | 2022-08-13 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | wavvmrp.mp3 | 2022-08-13 13:18 | 0 | |
![[SND]](/icons/sound2.gif) | ktdas.mp3 | 2022-08-13 13:17 | 3.2M | |
![[SND]](/icons/sound2.gif) | Ungol.mp3 | 2022-08-13 13:16 | 85K | |
![[SND]](/icons/sound2.gif) | 797393120.mp3 | 2022-08-13 13:15 | 3.8M | |
![[SND]](/icons/sound2.gif) | The Rolling Stones - Heaven.mp3 | 2022-08-13 13:15 | 0 | |
![[SND]](/icons/sound2.gif) | Патрон (remix).mp3 | 2022-08-13 13:14 | 0 | |
![[SND]](/icons/sound2.gif) | mai.mp3 | 2022-08-13 13:14 | 2.9M | |
![[SND]](/icons/sound2.gif) | Детство (Remix).mp3 | 2022-08-13 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | Суета (remix).mp3 | 2022-08-13 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | Стрелы.mp3 | 2022-08-13 13:11 | 0 | |
![[SND]](/icons/sound2.gif) | itwilrain.mp3 | 2022-08-13 13:11 | 0 | |
![[SND]](/icons/sound2.gif) | Беги (remix).mp3 | 2022-08-13 13:11 | 0 | |
![[SND]](/icons/sound2.gif) | -Kordhell - Live Another Day.mp3 | 2022-08-13 13:10 | 0 | |
![[SND]](/icons/sound2.gif) | MOBE1.mp3 | 2022-08-13 13:10 | 0 | |
![[SND]](/icons/sound2.gif) | Led Zeppelin -The Rain Song.mp3 | 2022-08-13 13:08 | 0 | |
![[SND]](/icons/sound2.gif) | Dilemma1.mp3 | 2022-08-13 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | murat-tkhagalegov-chuzhaja-nevesta.mp3 | 2022-08-13 13:06 | 11M | |
![[SND]](/icons/sound2.gif) | luyaa0.mp3 | 2022-08-13 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | miyagi.mp3 | 2022-08-13 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | SIKOK.mp3 | 2022-08-13 13:03 | 0 | |
![[SND]](/icons/sound2.gif) | Bjf.mp3 | 2022-08-13 12:59 | 1.2M | |
![[SND]](/icons/sound2.gif) | PharaoH - На Луне.mp3 | 2022-08-13 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | anjay.mp3 | 2022-08-13 12:45 | 7.0M | |
![[SND]](/icons/sound2.gif) | byines.mp3 | 2022-08-13 12:45 | 0 | |
![[SND]](/icons/sound2.gif) | Mursit3.mp3 | 2022-08-13 12:44 | 0 | |
![[SND]](/icons/sound2.gif) | stia.mp3 | 2022-08-13 12:42 | 0 | |
![[SND]](/icons/sound2.gif) | mursit2.mp3 | 2022-08-13 12:42 | 0 | |
![[SND]](/icons/sound2.gif) | shahmen-mark-remastered.mp3 | 2022-08-13 12:41 | 0 | |
![[SND]](/icons/sound2.gif) | asmara.mp3 | 2022-08-13 12:39 | 0 | |
![[SND]](/icons/sound2.gif) | Mursit1.mp3 | 2022-08-13 12:36 | 0 | |
![[SND]](/icons/sound2.gif) | D.mp3 | 2022-08-13 12:36 | 3.8M | |
![[SND]](/icons/sound2.gif) | Rap1.mp3 | 2022-08-13 12:35 | 4.7M | |
![[SND]](/icons/sound2.gif) | Yoi.mp3 | 2022-08-13 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | cukup1.mp3 | 2022-08-13 12:33 | 0 | |
![[SND]](/icons/sound2.gif) | Oliver_Tree_-_Jerk_70287833.mp3 | 2022-08-13 12:30 | 2.3M | |
![[SND]](/icons/sound2.gif) | XXXTENTACION - Hope.mp3 | 2022-08-13 12:29 | 0 | |
![[SND]](/icons/sound2.gif) | Hoa Ngọc Lan 2.mp3 | 2022-08-13 12:29 | 0 | |
![[SND]](/icons/sound2.gif) | DJ MARI SEMUA DANSA DENGANKU JEDAG JEDUG MENGKANE VIRAL TIKTOK [ DJ MARI BERCINTA ] MBON MBON REMIX.mp3 | 2022-08-13 12:27 | 0 | |
![[SND]](/icons/sound2.gif) | Yama11.mp3 | 2022-08-13 12:25 | 0 | |
![[SND]](/icons/sound2.gif) | BBHC.mp3 | 2022-08-13 12:24 | 624K | |
![[SND]](/icons/sound2.gif) | fendonOFF — Nikitata - Дресскод x Shadowraze - Astral step (www.lightaudio.ru).mp3 | 2022-08-13 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | meqmeq.mp3 | 2022-08-13 12:22 | 0 | |
![[SND]](/icons/sound2.gif) | riw - “Jump On, Jump On Me” (Sped Up).mp3 | 2022-08-13 12:18 | 1.3M | |
![[SND]](/icons/sound2.gif) | gov1.mp3 | 2022-08-13 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | lalalas.mp3 | 2022-08-13 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | cuy.mp3 | 2022-08-13 12:16 | 0 | |
![[SND]](/icons/sound2.gif) | _OLD GENESIS_ ( Prod Lemuel J. Sianipar ).mp3 | 2022-08-13 12:15 | 0 | |
![[SND]](/icons/sound2.gif) | antom.mp3 | 2022-08-13 12:14 | 184K | |
![[SND]](/icons/sound2.gif) | hutdog.mp3 | 2022-08-13 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | PseudoRauschSingnale (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-13 12:08 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx1.mp3 | 2022-08-13 12:07 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx3.mp3 | 2022-08-13 12:07 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx2.mp3 | 2022-08-13 12:06 | 0 | |
![[SND]](/icons/sound2.gif) | Zexx.mp3 | 2022-08-13 12:06 | 1.2M | |
![[SND]](/icons/sound2.gif) | zawanbeats-low.mp3 | 2022-08-13 12:06 | 412K | |
![[SND]](/icons/sound2.gif) | jj.mp3 | 2022-08-13 12:04 | 2.8M | |
![[SND]](/icons/sound2.gif) | SE.mp3 | 2022-08-13 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dilemma.mp3 | 2022-08-13 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | moon.mp3 | 2022-08-13 12:00 | 80K | |
![[SND]](/icons/sound2.gif) | epma.mp3 | 2022-08-13 11:57 | 4.7M | |
![[SND]](/icons/sound2.gif) | HRD2FACE.mp3 | 2022-08-13 11:50 | 3.7M | |
![[SND]](/icons/sound2.gif) | mmmm.mp3 | 2022-08-13 11:47 | 3.6M | |
![[SND]](/icons/sound2.gif) | gta1.mp3 | 2022-08-13 11:41 | 1.1M | |
![[SND]](/icons/sound2.gif) | ROG.mp3 | 2022-08-13 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | WENA VIRAL.mp3 | 2022-08-13 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | rnn.mp3 | 2022-08-13 11:38 | 2.4M | |
![[SND]](/icons/sound2.gif) | CG.mp3 | 2022-08-13 11:37 | 3.0M | |
![[SND]](/icons/sound2.gif) | DJ JUST BLOW - RSTURMIX X VIRAL TIKTOK YANG KALIAN CARII!!!.mp3 | 2022-08-13 11:35 | 0 | |
![[SND]](/icons/sound2.gif) | Test9.mp3 | 2022-08-13 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | dimegirls.mp3 | 2022-08-13 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | habibi.mp3 | 2022-08-13 11:30 | 2.0M | |
![[SND]](/icons/sound2.gif) | alex.mp3 | 2022-08-13 11:29 | 1.4M | |
![[SND]](/icons/sound2.gif) | From Disco saple.mp3 | 2022-08-13 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | ชักนมThis is my boss - Lucky Gang (Official Audio)เพลงแก๊งลักกี้ GTAV.mp3 | 2022-08-13 11:27 | 3.3M | |
![[SND]](/icons/sound2.gif) | Papuri Sa Diyos Remix.mp3 | 2022-08-13 11:25 | 1.2M | |
![[SND]](/icons/sound2.gif) | inbound841772282173309966.mp3 | 2022-08-13 11:22 | 0 | |
![[SND]](/icons/sound2.gif) | Merdeka.mp3 | 2022-08-13 11:21 | 0 | |
![[SND]](/icons/sound2.gif) | Papuri2.mp3 | 2022-08-13 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | ajoura_the_scp_foundation_main_theme_audio_spectrum_1hour_431074591912028817.mp3 | 2022-08-13 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | nenengb.mp3 | 2022-08-13 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | inbound44909169936502260.mp3 | 2022-08-13 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | kontrabida.mp3 | 2022-08-13 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | ff.mp3 | 2022-08-13 11:13 | 2.0M | |
![[SND]](/icons/sound2.gif) | gtaslowed.mp3 | 2022-08-13 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | JUKI -_ VILLAIN [ prod. ESKRY ].mp3 | 2022-08-13 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | djwb.mp3 | 2022-08-13 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | Yama2.mp3 | 2022-08-13 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | Maybe.mp3 | 2022-08-13 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - Doowhite On Tour - SAWMENOW x SIIKRET x MADBOZO Prod.TDKILL (Official MV) (128 kbps).mp3 | 2022-08-13 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | pwd2.mp3 | 2022-08-13 11:01 | 0 | |
![[SND]](/icons/sound2.gif) | g-Stick-your-finger-in-my-ass.mp3 | 2022-08-13 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | 1MILL.mp3 | 2022-08-13 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | FACE_-_MOJJ_KALASHNIKOV_61744829.mp3 | 2022-08-13 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | Yama4.mp3 | 2022-08-13 10:54 | 1.9M | |
![[SND]](/icons/sound2.gif) | g-What-the-hell-u-2-doing.mp3 | 2022-08-13 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | roberry.mp3 | 2022-08-13 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | san punta.mp3 | 2022-08-13 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | FACE_-_LABIRINT_66800217.mp3 | 2022-08-13 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | 20220607_154030.m4a | 2022-08-13 10:53 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN_-_RETRO_REJJV_72972901.mp3 | 2022-08-13 10:52 | 0 | |
![[SND]](/icons/sound2.gif) | OST_-_GTA_SA_-_Welcome_to_San_Andreas_64057826.mp3 | 2022-08-13 10:52 | 0 | |
![[SND]](/icons/sound2.gif) | face-spasatelnyj-krug-mp3.mp3 | 2022-08-13 10:52 | 0 | |
![[SND]](/icons/sound2.gif) | slava-marlow-agoniya-mp3 (1).mp3 | 2022-08-13 10:51 | 28K | |
![[SND]](/icons/sound2.gif) | shadowraze-showdown-mp3.mp3 | 2022-08-13 10:51 | 4.6M | |
![[SND]](/icons/sound2.gif) | face-labirint-mp3 (1).mp3 | 2022-08-13 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | neneng.mp3 | 2022-08-13 10:50 | 104K | |
![[SND]](/icons/sound2.gif) | slava-marlow-agoniya-mp3 (2).mp3 | 2022-08-13 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | ROBBERY.mp3 | 2022-08-13 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | vmrpanthem.mp3 | 2022-08-13 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | b.mp3 | 2022-08-13 10:46 | 4.0K | |
![[SND]](/icons/sound2.gif) | gayazov-brother-malinovaya-lada-mp3.mp3 | 2022-08-13 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | Markul_streli.mp3 | 2022-08-13 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | san ka punta.mp3 | 2022-08-13 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Ninn.mp3 | 2022-08-13 10:39 | 9.3M | |
![[SND]](/icons/sound2.gif) | cr.mp3 | 2022-08-13 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | One2.mp3 | 2022-08-13 10:32 | 3.5M | |
![[SND]](/icons/sound2.gif) | Hakdog.mp3 | 2022-08-13 10:30 | 0 | |
![[SND]](/icons/sound2.gif) | Clemu.mp3 | 2022-08-13 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | niogro.mp3 | 2022-08-13 10:26 | 0 | |
![[SND]](/icons/sound2.gif) | vp10.mp3 | 2022-08-13 10:25 | 0 | |
![[SND]](/icons/sound2.gif) | Simple Plan - Summer Paradise ft. Sean Paul (Official Video) (320 kbps).mp3 | 2022-08-13 10:24 | 3.5M | |
![[SND]](/icons/sound2.gif) | One3.mp3 | 2022-08-13 10:22 | 2.5M | |
![[SND]](/icons/sound2.gif) | Music Mix 2022 🎧 Remixes of Popular Songs 🎧 EDM Best Music Mix.mp3 | 2022-08-13 10:22 | 0 | |
![[SND]](/icons/sound2.gif) | กำลังฮิตในTikTok!! ( โอเคอายูเรดี้ - วอเอ๊ะๆ ) เพลงมาแรงในตอนนี้ 2022 [ดีเจจ๊อบ].mp3 | 2022-08-13 10:20 | 0 | |
![[SND]](/icons/sound2.gif) | sanjis01.mp3 | 2022-08-13 10:19 | 0 | |
![[SND]](/icons/sound2.gif) | sao.mp3 | 2022-08-13 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | กำลังฮิตในTikTok ( เอวติดไฟ -Bear Knuckle) V.แดนซ์ยกเบสหนัก ๆๆ Pao Remix.mp3 | 2022-08-13 10:16 | 0 | |
![[SND]](/icons/sound2.gif) | VØJ x TRVNSPORTER Destination (OFFICIAL VISUALIZER).mp3 | 2022-08-13 10:15 | 0 | |
![[SND]](/icons/sound2.gif) | iojk.mp3 | 2022-08-13 10:15 | 0 | |
![[SND]](/icons/sound2.gif) | Oten.mp3 | 2022-08-13 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | 231.mp3 | 2022-08-13 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Andrew.mp3 | 2022-08-13 10:11 | 1.9M | |
![[SND]](/icons/sound2.gif) | Myxart.mp3 | 2022-08-13 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Be Notorious (Title Track).mp3 | 2022-08-13 10:04 | 0 | |
![[SND]](/icons/sound2.gif) | gone-fludd_-_dripset-prod-by-leezey.mp3 | 2022-08-13 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Алилуя.mp3 | 2022-08-13 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Arthuro1.mp3 | 2022-08-13 09:58 | 1.5M | |
![[SND]](/icons/sound2.gif) | 𝓜𝓪𝓶𝓪𝓮𝓿 - Давай со мной до луны и.mp3 | 2022-08-13 09:58 | 1.0M | |
![[SND]](/icons/sound2.gif) | m23.mp3 | 2022-08-13 09:58 | 3.7M | |
![[SND]](/icons/sound2.gif) | Glooco5.mp3 | 2022-08-13 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Papuri.mp3 | 2022-08-13 09:57 | 1.2M | |
![[SND]](/icons/sound2.gif) | rxz.mp3 | 2022-08-13 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Glooco3.mp3 | 2022-08-13 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | NEW.mp3 | 2022-08-13 09:52 | 0 | |
![[SND]](/icons/sound2.gif) | remix.mp3 | 2022-08-13 09:51 | 2.4M | |
![[SND]](/icons/sound2.gif) | Manuel1.mp3 | 2022-08-13 09:47 | 0 | |
![[SND]](/icons/sound2.gif) | 𝖇 𝖑 𝖆 𝖈 𝖐🌹𝖜 𝖍 𝖎 𝖙 𝖊 - Звуки урбана [remix].mp3 | 2022-08-13 09:47 | 0 | |
![[SND]](/icons/sound2.gif) | asw.mp3 | 2022-08-13 09:47 | 2.7M | |
![[SND]](/icons/sound2.gif) | Мама.mp3 | 2022-08-13 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | vp.mp3 | 2022-08-13 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | Akala.mp3 | 2022-08-13 09:42 | 3.3M | |
![[SND]](/icons/sound2.gif) | k11.mp3 | 2022-08-13 09:41 | 0 | |
![[SND]](/icons/sound2.gif) | THINKIN.mp3 | 2022-08-13 09:39 | 0 | |
![[SND]](/icons/sound2.gif) | request200.mp3 | 2022-08-13 09:36 | 0 | |
![[SND]](/icons/sound2.gif) | Tibo.mp3 | 2022-08-13 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | ndx.mp3 | 2022-08-13 09:32 | 0 | |
![[SND]](/icons/sound2.gif) | TONY MOTARO - Boomer Phonk.mp3 | 2022-08-13 09:32 | 0 | |
![[SND]](/icons/sound2.gif) | Panda.mp3 | 2022-08-13 09:31 | 1.9M | |
![[SND]](/icons/sound2.gif) | pelangindx.mp3 | 2022-08-13 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | AD.mp3 | 2022-08-13 09:30 | 3.9M | |
![[SND]](/icons/sound2.gif) | ssds.mp3 | 2022-08-13 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | IPMOSIBL.mp3 | 2022-08-13 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | Mr.Kitty - After Dark.mp3 | 2022-08-13 09:29 | 0 | |
![[SND]](/icons/sound2.gif) | Skill.mp3 | 2022-08-13 09:28 | 0 | |
![[SND]](/icons/sound2.gif) | zodivk-devil-eyes-mp3.mp3 | 2022-08-13 09:28 | 5.2M | |
![[SND]](/icons/sound2.gif) | PapuriRemix.mp3 | 2022-08-13 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | puscarie.mp3 | 2022-08-13 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - Move On NDX A.K.A #Lirik (128 kbps).mp3 | 2022-08-13 09:21 | 0 | |
![[SND]](/icons/sound2.gif) | bagas.mp3 | 2022-08-13 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | The Sh-Booms - Sh-Boom (Life Could Be a Dream).mp3 | 2022-08-13 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | Ford.mp3 | 2022-08-13 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | The Walters - I Love You So.mp3 | 2022-08-13 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | l-lirik.mp3 | 2022-08-13 09:10 | 0 | |
![[SND]](/icons/sound2.gif) | mygoo.mp3 | 2022-08-13 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | happierkaka.mp3 | 2022-08-13 09:08 | 0 | |
![[SND]](/icons/sound2.gif) | Black.mp3 | 2022-08-13 09:04 | 2.4M | |
![[SND]](/icons/sound2.gif) | sean.mp3 | 2022-08-13 09:02 | 0 | |
![[SND]](/icons/sound2.gif) | Konfuz-Кайф ты поймала -минус--kissvk.com(1).mp3 | 2022-08-13 09:02 | 0 | |
![[SND]](/icons/sound2.gif) | jnh.mp3 | 2022-08-13 08:57 | 0 | |
![[SND]](/icons/sound2.gif) | HLD.mp3 | 2022-08-13 08:56 | 1.0M | |
![[SND]](/icons/sound2.gif) | Angel.mp3 | 2022-08-13 08:55 | 3.4M | |
![[SND]](/icons/sound2.gif) | Rex.mp3 | 2022-08-13 08:54 | 2.8M | |
![[SND]](/icons/sound2.gif) | GEY.mp3 | 2022-08-13 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | saan.mp3 | 2022-08-13 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | Смешарики - От Винта (Bass Boosted By Лампочка 30db) (mp3-2020.com).mp3 | 2022-08-13 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | 1skill.mp3 | 2022-08-13 08:42 | 0 | |
![[SND]](/icons/sound2.gif) | WEGAS, LIANTO, ARCHI - И пусть.mp3 | 2022-08-13 08:39 | 3.2M | |
![[SND]](/icons/sound2.gif) | tipe-x.mp3 | 2022-08-13 08:39 | 0 | |
![[SND]](/icons/sound2.gif) | 𝕤𝕠𝕦𝕝-𝕄𝕦𝕤𝕚𝕔🎶-𝐘𝐮𝐧𝐨𝐬𝐭.mp3 | 2022-08-13 08:37 | 0 | |
![[SND]](/icons/sound2.gif) | CYGO - Panda E.mp3 | 2022-08-13 08:35 | 0 | |
![[SND]](/icons/sound2.gif) | Sohodolls - Pleasures of Soho.mp3 | 2022-08-13 08:35 | 0 | |
![[SND]](/icons/sound2.gif) | Ama.mp3 | 2022-08-13 08:35 | 1.5M | |
![[SND]](/icons/sound2.gif) | REDDY30.mp3 | 2022-08-13 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | birth.mp3 | 2022-08-13 08:32 | 0 | |
![[SND]](/icons/sound2.gif) | briyanall.mp3 | 2022-08-13 08:30 | 0 | |
![[SND]](/icons/sound2.gif) | Çakal - İmdat (Sözleri_Lyrics).m4a | 2022-08-13 08:29 | 0 | |
![[SND]](/icons/sound2.gif) | animal.mp3.mp3 | 2022-08-13 08:26 | 0 | |
![[SND]](/icons/sound2.gif) | Markul, Тося Чайкина - Стрелы.mp3 | 2022-08-13 08:24 | 0 | |
![[VID]](/icons/movie.gif) | X2Download.com- (1).mp4 | 2022-08-13 08:22 | 0 | |
![[SND]](/icons/sound2.gif) | awitin.mp3.mp3 | 2022-08-13 08:22 | 0 | |
![[SND]](/icons/sound2.gif) | dapainzz.mp3 | 2022-08-13 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | Guerro1.mp3 | 2022-08-13 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | sosweet.mp3.mp3 | 2022-08-13 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | sweet.mp3.mp3 | 2022-08-13 08:12 | 0 | |
![[SND]](/icons/sound2.gif) | Tennis - How To Forgive (Visualizer).mp3 | 2022-08-13 08:12 | 0 | |
![[SND]](/icons/sound2.gif) | Patriot.mp3 | 2022-08-13 08:10 | 0 | |
![[SND]](/icons/sound2.gif) | patriot.mp3 | 2022-08-13 08:09 | 0 | |
![[SND]](/icons/sound2.gif) | dkk2.mp3 | 2022-08-13 08:08 | 0 | |
![[SND]](/icons/sound2.gif) | galon.mp3 | 2022-08-13 08:08 | 501K | |
![[SND]](/icons/sound2.gif) | Zetsuke.mp3 | 2022-08-13 07:53 | 1.7M | |
![[SND]](/icons/sound2.gif) | empiree.mp3 | 2022-08-13 07:53 | 1.8M | |
![[SND]](/icons/sound2.gif) | 20.mp3 | 2022-08-13 07:46 | 2.9M | |
![[SND]](/icons/sound2.gif) | Jhon14.mp3 | 2022-08-13 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | All Too Well _ Taylor Swift (Lyrics).mp3 | 2022-08-13 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | boigiuadaiduong.mp3 | 2022-08-13 07:45 | 0 | |
![[SND]](/icons/sound2.gif) | mgabobo.mp3 | 2022-08-13 07:43 | 0 | |
![[SND]](/icons/sound2.gif) | touch.mp3.mp3 | 2022-08-13 07:42 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - naanga vanthale vedigundu song whatsapp status havoc brothers songs gkarthi kn.mp3 | 2022-08-13 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | OMFG_-_Hello_(musmore.com).mp3 | 2022-08-13 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | payphone.mp3.mp3 | 2022-08-13 07:32 | 0 | |
![[SND]](/icons/sound2.gif) | ganonparen.mp3.mp3 | 2022-08-13 07:25 | 0 | |
![[SND]](/icons/sound2.gif) | touch by touch.mp3.mp3 | 2022-08-13 07:21 | 1.7M | |
![[SND]](/icons/sound2.gif) | phup.mp3 | 2022-08-13 07:20 | 0 | |
![[SND]](/icons/sound2.gif) | EMPILIGHT BY JONAS.mp3 | 2022-08-13 07:19 | 4.0K | |
![[SND]](/icons/sound2.gif) | aaa.mp3 | 2022-08-13 07:19 | 2.0M | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ GENJER GENJER FULL BASS.mp3 | 2022-08-13 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Rolex.mp3 | 2022-08-13 07:15 | 872K | |
![[SND]](/icons/sound2.gif) | TOUCH.mp3.mp3 | 2022-08-13 07:15 | 0 | |
![[SND]](/icons/sound2.gif) | JJ1.mp3 | 2022-08-13 07:12 | 0 | |
![[SND]](/icons/sound2.gif) | Rolex Theme Video - Vikram - Kamal Haasan - ANIRUDH RAVICHANDER - Lokesh Kanagaraj.mp3 | 2022-08-13 07:12 | 0 | |
![[SND]](/icons/sound2.gif) | TOUCH BY TOUCH-by-Joy(w_lyrics)created by_Zairah.mp3 | 2022-08-13 07:11 | 0 | |
![[SND]](/icons/sound2.gif) | GetMyWay.mp3 | 2022-08-13 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | big_baby_tape_-_99_problems_(feat._kizaru)_muzati.net.mp3 | 2022-08-13 07:00 | 0 | |
![[SND]](/icons/sound2.gif) | whataboutme.mp3 | 2022-08-13 06:57 | 0 | |
![[SND]](/icons/sound2.gif) | The Weeknd - Blinding Lights (Lyrics) (1).mp3 | 2022-08-13 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | mkrvnolvka-Киберпанки2077_(smyslpesni.ru).mp3 | 2022-08-13 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | aarne-big-baby-tape-ski-ski.mp3 | 2022-08-13 06:55 | 612K | |
![[SND]](/icons/sound2.gif) | Jhon11.mp3 | 2022-08-13 06:53 | 9.4M | |
![[SND]](/icons/sound2.gif) | koplim.mp3 | 2022-08-13 06:52 | 0 | |
![[SND]](/icons/sound2.gif) | iwanna.Mp3.mp3 | 2022-08-13 06:50 | 0 | |
![[SND]](/icons/sound2.gif) | Jhon12.mp3 | 2022-08-13 06:50 | 2.1M | |
![[SND]](/icons/sound2.gif) | vmrp22.mp3 | 2022-08-13 06:50 | 0 | |
![[SND]](/icons/sound2.gif) | newaugj.mp3 | 2022-08-13 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | vmrpaug.mp3 | 2022-08-13 06:48 | 0 | |
![[SND]](/icons/sound2.gif) | anto22.mp3 | 2022-08-13 06:48 | 1.9M | |
![[SND]](/icons/sound2.gif) | videoplayback - 2022-08-13T121514.342.mp3 | 2022-08-13 06:46 | 0 | |
![[SND]](/icons/sound2.gif) | Vmrpaug.mp3 | 2022-08-13 06:44 | 0 | |
![[SND]](/icons/sound2.gif) | aarne-big-baby-tape-ski-ski-mp3.mp3 | 2022-08-13 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | Test50.mp3 | 2022-08-13 06:42 | 0 | |
![[SND]](/icons/sound2.gif) | edm.mp3 | 2022-08-13 06:41 | 1.6M | |
![[SND]](/icons/sound2.gif) | Glimpes of Us.mp3 | 2022-08-13 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | mengejar.mp3 | 2022-08-13 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | Test8.mp3 | 2022-08-13 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | loki.mp3 | 2022-08-13 06:37 | 2.3M | |
![[SND]](/icons/sound2.gif) | Naruto.mp3 | 2022-08-13 06:35 | 3.8M | |
![[SND]](/icons/sound2.gif) | Test7.mp3 | 2022-08-13 06:34 | 0 | |
![[SND]](/icons/sound2.gif) | RR.mp3 | 2022-08-13 06:33 | 2.1M | |
![[SND]](/icons/sound2.gif) | Yama3.mp3 | 2022-08-13 06:33 | 2.2M | |
![[SND]](/icons/sound2.gif) | Jhon10.mp3 | 2022-08-13 06:32 | 8.7M | |
![[SND]](/icons/sound2.gif) | Test13.mp3 | 2022-08-13 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | Yama5.mp3 | 2022-08-13 06:29 | 2.8M | |
![[SND]](/icons/sound2.gif) | Test12.mp3 | 2022-08-13 06:28 | 0 | |
![[SND]](/icons/sound2.gif) | Test11.mp3 | 2022-08-13 06:26 | 0 | |
![[SND]](/icons/sound2.gif) | MV มองได้แต่อย่าชอบ (Official mv OST. ATM) (1).mp3 | 2022-08-13 06:24 | 0 | |
![[SND]](/icons/sound2.gif) | Test10.mp3 | 2022-08-13 06:24 | 440K | |
![[SND]](/icons/sound2.gif) | mantrahujan.mp3 | 2022-08-13 06:23 | 1.7M | |
![[SND]](/icons/sound2.gif) | 【ORIGINAL SONG MV】Mantra Hujan - Kobo Kanaeru 【hololive Indonesia 3rd Gen】.mp3 | 2022-08-13 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | BANCAWAT.mp3 | 2022-08-13 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | Test6.mp3 | 2022-08-13 06:17 | 5.3M | |
![[SND]](/icons/sound2.gif) | g5.mp3 | 2022-08-13 06:15 | 1.2M | |
![[SND]](/icons/sound2.gif) | m6.mp3 | 2022-08-13 06:13 | 4.2M | |
![[SND]](/icons/sound2.gif) | m5.mp3 | 2022-08-13 06:13 | 0 | |
![[SND]](/icons/sound2.gif) | NDX A.K.A Rasah Dadi Pelangi.mp3 | 2022-08-13 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | Test5.mp3 | 2022-08-13 06:10 | 2.0M | |
![[SND]](/icons/sound2.gif) | musik.mp3 | 2022-08-13 06:10 | 524K | |
![[SND]](/icons/sound2.gif) | ssstik.io_1658333440017.mp3 | 2022-08-13 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Test4.mp3 | 2022-08-13 06:07 | 2.0M | |
![[SND]](/icons/sound2.gif) | untilfaund.mp3 | 2022-08-13 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | kizumada - macabre.mp3 | 2022-08-13 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | mp7.mp3 | 2022-08-13 06:02 | 4.3M | |
![[SND]](/icons/sound2.gif) | nk.mp3 | 2022-08-13 06:02 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_showdown_muzati.net.mp3 | 2022-08-13 05:58 | 4.6M | |
![[SND]](/icons/sound2.gif) | Raze.mp3 | 2022-08-13 05:58 | 902K | |
![[SND]](/icons/sound2.gif) | Test3.mp3 | 2022-08-13 05:58 | 2.5M | |
![[SND]](/icons/sound2.gif) | jhw1.mp3 | 2022-08-13 05:58 | 0 | |
![[SND]](/icons/sound2.gif) | tm20.mp3 | 2022-08-13 05:56 | 4.4M | |
![[SND]](/icons/sound2.gif) | tm21.mp3 | 2022-08-13 05:56 | 0 | |
![[SND]](/icons/sound2.gif) | mp24.mp3 | 2022-08-13 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Haftway.mp3 | 2022-08-13 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Jason Haft - Bahay Katay (Freestyle Battle Beat).mp3 | 2022-08-13 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | mp40.mp3 | 2022-08-13 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | jason.mp3 | 2022-08-13 05:53 | 0 | |
![[SND]](/icons/sound2.gif) | Meremp3.mp3 | 2022-08-13 05:53 | 0 | |
![[SND]](/icons/sound2.gif) | g1.mp3 | 2022-08-13 05:53 | 2.4M | |
![[SND]](/icons/sound2.gif) | g4.mp3 | 2022-08-13 05:53 | 3.5M | |
![[VID]](/icons/movie.gif) | test.mp4 | 2022-08-13 05:53 | 0 | |
![[SND]](/icons/sound2.gif) | m3.mp3 | 2022-08-13 05:52 | 3.5M | |
![[SND]](/icons/sound2.gif) | m4.mp3 | 2022-08-13 05:52 | 3.5M | |
![[SND]](/icons/sound2.gif) | haft.mp3 | 2022-08-13 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | Test2.mp3 | 2022-08-13 05:45 | 2.4M | |
![[SND]](/icons/sound2.gif) | Luisterboek Kleine Overheid - Maarten van Rossem.mp3 | 2022-08-13 05:45 | 0 | |
![[SND]](/icons/sound2.gif) | My G is HARAM _ Official MV.mp3 | 2022-08-13 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | Test1.mp3 | 2022-08-13 05:42 | 2.7M | |
![[SND]](/icons/sound2.gif) | Djslow.mp3 | 2022-08-13 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | Feitz1.mp3 | 2022-08-13 05:37 | 0 | |
![[SND]](/icons/sound2.gif) | am1.mp3 | 2022-08-13 05:37 | 0 | |
![[SND]](/icons/sound2.gif) | tera.mp3 | 2022-08-13 05:35 | 0 | |
![[SND]](/icons/sound2.gif) | Video nicht verfügbar (URBANOMP3.NET) (14).mp3 | 2022-08-13 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | caidiasd.mp3 | 2022-08-13 05:29 | 0 | |
![[SND]](/icons/sound2.gif) | Vacation.mp3 | 2022-08-13 05:28 | 0 | |
![[SND]](/icons/sound2.gif) | lovenhe.mp3 | 2022-08-13 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | Fdr MusiQ-Danko (feat Tr3azy_a1).mp3 | 2022-08-13 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | Thudakam.mp3 | 2022-08-13 05:20 | 0 | |
![[SND]](/icons/sound2.gif) | Krutoezvuchanie.mp3 | 2022-08-13 05:19 | 0 | |
![[SND]](/icons/sound2.gif) | Tatang2.mp3 | 2022-08-13 05:17 | 0 | |
![[SND]](/icons/sound2.gif) | jowo2.mp3 | 2022-08-13 05:17 | 0 | |
![[SND]](/icons/sound2.gif) | kuduk.mp3 | 2022-08-13 05:13 | 0 | |
![[SND]](/icons/sound2.gif) | Anjay2.mp3 | 2022-08-13 05:13 | 0 | |
![[SND]](/icons/sound2.gif) | SHADE.mp3.mp3 | 2022-08-13 05:13 | 0 | |
![[SND]](/icons/sound2.gif) | Anjay1.mp3 | 2022-08-13 05:12 | 0 | |
![[SND]](/icons/sound2.gif) | luce2.mp3 | 2022-08-13 05:12 | 0 | |
![[SND]](/icons/sound2.gif) | Madan1.mp3 | 2022-08-13 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | sikok.mp3 | 2022-08-13 05:08 | 4.6M | |
![[SND]](/icons/sound2.gif) | berdua.m4a | 2022-08-13 05:08 | 0 | |
![[SND]](/icons/sound2.gif) | jogja.mp3 | 2022-08-13 05:07 | 400K | |
![[SND]](/icons/sound2.gif) | ❤乡𝙎𝙤𝙣𝙢𝙤𝙧乡❤ — Катюша (Phonk Remix by KAMCHATSKYCRAB ft. Cake Beatz) (www.lightaudio.ru).mp3 | 2022-08-13 05:06 | 0 | |
![[SND]](/icons/sound2.gif) | Dalaga.mp3 | 2022-08-13 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220807-WA0000.mp3 | 2022-08-13 05:04 | 0 | |
![[SND]](/icons/sound2.gif) | empire.mp3 | 2022-08-13 05:04 | 0 | |
![[SND]](/icons/sound2.gif) | Binata.mp3 | 2022-08-13 05:04 | 0 | |
![[SND]](/icons/sound2.gif) | DJSIKOKBAGIDUOREMIXPALEMBANGJEDAGJEDUGMENGKANEVIRALTIKTOK_492.m4a | 2022-08-13 05:02 | 0 | |
![[SND]](/icons/sound2.gif) | kullbert.mp3 | 2022-08-13 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | terluka.mp3 | 2022-08-13 04:55 | 4.3M | |
![[SND]](/icons/sound2.gif) | galau brutal.mp3 | 2022-08-13 04:54 | 0 | |
![[SND]](/icons/sound2.gif) | b4.mp3 | 2022-08-13 04:52 | 0 | |
![[SND]](/icons/sound2.gif) | mp25.mp3 | 2022-08-13 04:50 | 0 | |
![[SND]](/icons/sound2.gif) | miduacinta.mp3 | 2022-08-13 04:50 | 0 | |
![[SND]](/icons/sound2.gif) | thde.mp3 | 2022-08-13 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | mc2.mp3 | 2022-08-13 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | mc.mp3 | 2022-08-13 04:44 | 2.0M | |
![[SND]](/icons/sound2.gif) | mc3.mp3 | 2022-08-13 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | mc4.mp3 | 2022-08-13 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | mc5.mp3 | 2022-08-13 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | ebanko-lyubitel-sobak-ya-ebu-sobak.mp3 | 2022-08-13 04:42 | 5.1M | |
![[SND]](/icons/sound2.gif) | The Living Tombstone.mp3 | 2022-08-13 04:36 | 2.8M | |
![[SND]](/icons/sound2.gif) | LKK.mp3 | 2022-08-13 04:33 | 0 | |
![[SND]](/icons/sound2.gif) | b3.mp3 | 2022-08-13 04:32 | 0 | |
![[SND]](/icons/sound2.gif) | DJ_INILAH_AKU_RAJA_MEKSIKO_WINDAH_BASUDARA_VIRAL_TIK_TOK_TERBARU_2022(256k).mp3 | 2022-08-13 04:29 | 764K | |
![[SND]](/icons/sound2.gif) | b2.mp3 | 2022-08-13 04:29 | 1.8M | |
![[SND]](/icons/sound2.gif) | KISS.mp3 | 2022-08-13 04:24 | 3.9M | |
![[SND]](/icons/sound2.gif) | OPK.mp3 | 2022-08-13 04:23 | 0 | |
![[VID]](/icons/movie.gif) | Project Fii - 175 _ Style 2 [1728F2C].mp4 | 2022-08-13 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | OP.mp3 | 2022-08-13 04:14 | 0 | |
![[SND]](/icons/sound2.gif) | Mamz01.mp3 | 2022-08-13 04:10 | 0 | |
![[SND]](/icons/sound2.gif) | Cover2.mp3 | 2022-08-13 04:10 | 0 | |
![[SND]](/icons/sound2.gif) | Cover1.mp3 | 2022-08-13 04:09 | 0 | |
![[SND]](/icons/sound2.gif) | midua cinta.mp3 | 2022-08-13 04:09 | 0 | |
![[SND]](/icons/sound2.gif) | DJAKIMILAKUMASIHGANTENGREMIXVIRALTIKTOKTERBARU2022_657.m4a | 2022-08-13 04:08 | 476K | |
![[SND]](/icons/sound2.gif) | b1.mp3 | 2022-08-13 04:06 | 2.1M | |
![[SND]](/icons/sound2.gif) | Tren Sexual (letra) _ Pedro Suárez Vértiz (320 kbps).mp3 | 2022-08-13 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | roxette - Itu0027s Possible Version One lyrics (YTCONVERT.IN).mp3 | 2022-08-13 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | DJ_NO_COMMENT_TUTY_WIBOWO_SOUND_RULL_𝐏𝐑𝐄𝐒𝐄𝐓_VIRAL_FYP_T_n4HqwThT094 (1).mp3 | 2022-08-13 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | OnlyMP3.to - Inscryption OST 23 - G0lly's Theme (Uploading)-WHi6TMmQaO0-192k-1643515093319.mp3 | 2022-08-13 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | PALOMA AJENA - Aguamarina (YTCONVERT.IN).mp3 | 2022-08-13 04:00 | 0 | |
![[SND]](/icons/sound2.gif) | BDM.mp3 | 2022-08-13 03:57 | 0 | |
![[SND]](/icons/sound2.gif) | stack game bgm.mp3 | 2022-08-13 03:52 | 0 | |
![[SND]](/icons/sound2.gif) | No One Else.mp3 | 2022-08-13 03:49 | 0 | |
![[SND]](/icons/sound2.gif) | c3bdb5b8e5ebd8e9a8a84e38f84f879c.mp3 | 2022-08-13 03:48 | 0 | |
![[SND]](/icons/sound2.gif) | dem.mp3 | 2022-08-13 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | Dj2.mp3 | 2022-08-13 03:44 | 2.4M | |
![[SND]](/icons/sound2.gif) | Until.mp3 | 2022-08-13 03:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | black.mp3 | 2022-08-13 03:38 | 2.4M | |
![[SND]](/icons/sound2.gif) | ruok.mp3 | 2022-08-13 03:37 | 0 | |
![[SND]](/icons/sound2.gif) | regards.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | pal.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | sick.mp3 | 2022-08-13 03:35 | 0 | |
![[SND]](/icons/sound2.gif) | mp19.mp3 | 2022-08-13 03:33 | 136K | |
![[SND]](/icons/sound2.gif) | P.P.P.mp3 | 2022-08-13 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | mixkit-message-pop-alert-2354.mp3 | 2022-08-13 03:30 | 46K | |
![[SND]](/icons/sound2.gif) | mp23.mp3 | 2022-08-13 03:30 | 0 | |
![[SND]](/icons/sound2.gif) | V4.mp3 | 2022-08-13 03:29 | 3.3M | |
![[SND]](/icons/sound2.gif) | mp22.mp3 | 2022-08-13 03:27 | 4.7M | |
![[SND]](/icons/sound2.gif) | BDM1.mp3 | 2022-08-13 03:27 | 104K | |
![[SND]](/icons/sound2.gif) | Dj1.mp3 | 2022-08-13 03:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Arms.mp3 | 2022-08-13 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | Abang.mp3 | 2022-08-13 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | Alsa.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lonte1.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Kemerdekaan.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | SBD12.mp3 | 2022-08-13 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | Funkot1.mp3 | 2022-08-13 03:18 | 0 | |
![[SND]](/icons/sound2.gif) | Enakniam12.mp3 | 2022-08-13 03:17 | 0 | |
![[SND]](/icons/sound2.gif) | andrew.mp3 | 2022-08-13 03:11 | 3.2M | |
![[VID]](/icons/movie.gif) | Lost (1).mp4 | 2022-08-13 03:08 | 0 | |
![[SND]](/icons/sound2.gif) | S6.mp3 | 2022-08-13 03:04 | 2.7M | |
![[SND]](/icons/sound2.gif) | S5.mp3 | 2022-08-13 03:04 | 3.3M | |
![[SND]](/icons/sound2.gif) | S3.mp3 | 2022-08-13 03:03 | 2.4M | |
![[SND]](/icons/sound2.gif) | S4.mp3 | 2022-08-13 03:03 | 3.6M | |
![[SND]](/icons/sound2.gif) | S2.mp3 | 2022-08-13 03:03 | 2.4M | |
![[SND]](/icons/sound2.gif) | S1.mp3 | 2022-08-13 03:03 | 1.5M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lagu Kemerdekaan RI 17 Agustus 1945.mp3 | 2022-08-13 03:01 | 168K | |
![[SND]](/icons/sound2.gif) | stay.mp3 | 2022-08-13 02:49 | 2.4M | |
![[SND]](/icons/sound2.gif) | Last night.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | Gtw.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | kagome.mp3 | 2022-08-13 02:48 | 3.7M | |
![[SND]](/icons/sound2.gif) | Falz.mp3 | 2022-08-13 02:48 | 0 | |
![[SND]](/icons/sound2.gif) | VP7.mp3 | 2022-08-13 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | Grandfather Time.mp3 | 2022-08-13 02:46 | 0 | |
![[SND]](/icons/sound2.gif) | 29_sua_01.mp3 | 2022-08-13 02:42 | 0 | |
![[SND]](/icons/sound2.gif) | 海伦 - 画离弦.mp3 | 2022-08-13 02:40 | 0 | |
![[SND]](/icons/sound2.gif) | Stay.mp3 | 2022-08-13 02:40 | 1.9M | |
![[SND]](/icons/sound2.gif) | LXSTODIUMmusic.mp3 | 2022-08-13 02:27 | 0 | |
![[SND]](/icons/sound2.gif) | pesni_dly_barvifi.mp3 | 2022-08-13 02:21 | 1.2M | |
![[SND]](/icons/sound2.gif) | TakeMeHome.mp3 | 2022-08-13 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - BURUH TANI - MARJINAL __ COVER BY REGITA ECHA (LYRIC) (64 kbps).mp3 | 2022-08-13 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | fallen kingdom.mp3 | 2022-08-13 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | lgw.mp3 | 2022-08-13 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - FUNABASHI DAYLIGHT ARCHIE COVER.mp3 | 2022-08-13 01:56 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - public domain archie edit_2.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022- 26032022.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - no name_2.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - TECHENKO 200821.mp3 | 2022-08-13 01:55 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - FEDO - BE ORIGINAL (ARCHIE DUB).mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | Mb.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 27112021.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - ARCHIE ID.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - riverside.mp3 | 2022-08-13 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - fest_rozpruwacz_dupy.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - ARCHIE FT EQUINOX LAST ONE TO DIE.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 01022022.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 27032022tech-pigeon.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 21112020.mp3 | 2022-08-13 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 18112020 intro edm.mp3 | 2022-08-13 01:52 | 0 | |
![[SND]](/icons/sound2.gif) | 12082022 - 02042022.mp3 | 2022-08-13 01:52 | 0 | |
![[SND]](/icons/sound2.gif) | لا تنسي الاشتراك في القناة.mp3 | 2022-08-13 01:45 | 0 | |
![[VID]](/icons/movie.gif) | QO.mp4 | 2022-08-13 01:43 | 0 | |
![[VID]](/icons/movie.gif) | Vp5.mp4 | 2022-08-13 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | QO.mp3 | 2022-08-13 01:37 | 2.8M | |
![[SND]](/icons/sound2.gif) | TOT.mp3 | 2022-08-13 01:36 | 0 | |
![[SND]](/icons/sound2.gif) | TO.mp3 | 2022-08-13 01:34 | 4.3M | |
![[SND]](/icons/sound2.gif) | OT.mp3 | 2022-08-13 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | TR.mp3 | 2022-08-13 01:30 | 200K | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-bandana-mp3.mp3 | 2022-08-13 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | Vp6.mp3 | 2022-08-13 01:26 | 384K | |
![[SND]](/icons/sound2.gif) | Recording (5).mp3 | 2022-08-13 01:18 | 0 | |
![[SND]](/icons/sound2.gif) | QC.mp3 | 2022-08-13 01:17 | 0 | |
![[SND]](/icons/sound2.gif) | QR.mp3 | 2022-08-13 01:16 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rain Noise Rain Sound Effect No Copyright Nature Sounds720P HD.mp3 | 2022-08-13 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | BM.mp3 | 2022-08-13 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | sunrf.mp3 | 2022-08-13 01:12 | 0 | |
![[SND]](/icons/sound2.gif) | OQ.mp3 | 2022-08-13 01:11 | 1.3M | |
![[SND]](/icons/sound2.gif) | DO.mp3 | 2022-08-13 01:08 | 0 | |
![[SND]](/icons/sound2.gif) | DR.mp3 | 2022-08-13 01:07 | 0 | |
![[SND]](/icons/sound2.gif) | k10.mp3 | 2022-08-13 01:06 | 1.0M | |
![[SND]](/icons/sound2.gif) | DH.mp3 | 2022-08-13 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | DD.mp3 | 2022-08-13 01:02 | 3.5M | |
![[SND]](/icons/sound2.gif) | DJ.mp3 | 2022-08-13 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | k7.mp3 | 2022-08-13 00:51 | 0 | |
![[SND]](/icons/sound2.gif) | S23.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S25.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S24.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S22.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S21.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | S20.mp3 | 2022-08-13 00:46 | 0 | |
![[SND]](/icons/sound2.gif) | Faizan1.mp3 | 2022-08-13 00:43 | 0 | |
![[SND]](/icons/sound2.gif) | أغنية مضحكة أمازيغية(MP3_320K).mp3 | 2022-08-13 00:38 | 0 | |
![[SND]](/icons/sound2.gif) | k9.mp3 | 2022-08-13 00:37 | 5.1M | |
![[SND]](/icons/sound2.gif) | 2022.mp3 | 2022-08-13 00:35 | 3.5M | |
![[SND]](/icons/sound2.gif) | k8.mp3 | 2022-08-13 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | Mourad Majjoud - Jibi Police ( Ayli Ayli ) مراد مجود - جيبي البوليس(MP3_320K).mp3 | 2022-08-13 00:20 | 0 | |
![[SND]](/icons/sound2.gif) | BEN0.mp3 | 2022-08-13 00:11 | 0 | |
![[SND]](/icons/sound2.gif) | bellucci🇮🇹 _ inst_1nurovv - шахрезад «remix» (www.hotplayer.ru).mp3 | 2022-08-13 00:09 | 0 | |
![[SND]](/icons/sound2.gif) | prom.mp3 | 2022-08-13 00:09 | 1.8M | |
![[SND]](/icons/sound2.gif) | hamil.mp3 | 2022-08-13 00:08 | 1.7M | |
![[SND]](/icons/sound2.gif) | Cooking_ Great! - The Legend of Zelda_ Breath of the Wild Sound Effect (128 kbps).mp3 | 2022-08-13 00:08 | 0 | |
![[SND]](/icons/sound2.gif) | apakabarsayang.mp3 | 2022-08-13 00:06 | 0 | |
![[SND]](/icons/sound2.gif) | samp.mp3 | 2022-08-12 23:52 | 4.1M | |
![[SND]](/icons/sound2.gif) | ToiMuonYeuMotNguoi-KhoiMy-5550418.mp3 | 2022-08-12 23:50 | 0 | |
![[SND]](/icons/sound2.gif) | shade rex.mp3 | 2022-08-12 23:42 | 0 | |
![[SND]](/icons/sound2.gif) | maanghang.mp3 | 2022-08-12 23:39 | 0 | |
![[SND]](/icons/sound2.gif) | M.I.B JAK.mp3 | 2022-08-12 23:34 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660346521753.mp3 | 2022-08-12 23:25 | 0 | |
![[SND]](/icons/sound2.gif) | In Game Music Suite (Zuma Deluxe).mp3 | 2022-08-12 23:18 | 0 | |
![[SND]](/icons/sound2.gif) | Убей меня, Эйс! – Милая трагедия.mp3 | 2022-08-12 23:11 | 0 | |
![[SND]](/icons/sound2.gif) | ktt.mp3 | 2022-08-12 23:07 | 0 | |
![[SND]](/icons/sound2.gif) | Hal18.mp3 | 2022-08-12 22:47 | 0 | |
![[SND]](/icons/sound2.gif) | akucoba.m4a | 2022-08-12 22:39 | 0 | |
![[SND]](/icons/sound2.gif) | misha-xramovi-vigimi-mp3.mp3 | 2022-08-12 22:32 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa61.mp3 | 2022-08-12 22:31 | 0 | |
![[SND]](/icons/sound2.gif) | tagne.mp3 | 2022-08-12 22:25 | 0 | |
![[SND]](/icons/sound2.gif) | Dere - Berisik (lirik).mp3 | 2022-08-12 22:23 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa4.mp3 | 2022-08-12 22:21 | 0 | |
![[SND]](/icons/sound2.gif) | manu_chao_me_gustas_tu_speed_up-mob4ik.com.mp3 | 2022-08-12 22:20 | 716K | |
![[SND]](/icons/sound2.gif) | ya.mp3 | 2022-08-12 22:20 | 3.0M | |
![[SND]](/icons/sound2.gif) | Budi Doremi - Melukis Senja (Official Video).mp3 | 2022-08-12 22:19 | 0 | |
![[SND]](/icons/sound2.gif) | CG5 — Mommy's Here (www.lightaudio.ru).mp3 | 2022-08-12 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | cover2.mp3 | 2022-08-12 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | cover1.mp3 | 2022-08-12 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | Audio Message M.mp3 | 2022-08-12 22:11 | 304K | |
![[SND]](/icons/sound2.gif) | Anthony Zhang.mp3 | 2022-08-12 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | AZhangWhisky.mp3 | 2022-08-12 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | AZhang.mp3 | 2022-08-12 21:55 | 0 | |
![[SND]](/icons/sound2.gif) | Jose ++Elvis Presley .mp3 | 2022-08-12 21:48 | 7.0M | |
![[SND]](/icons/sound2.gif) | Anthony Zhang 1.mp3 | 2022-08-12 21:43 | 0 | |
![[SND]](/icons/sound2.gif) | Aarne_Tesno_Feat_BUSHIDO_ZHO_ANIKV.mp3 | 2022-08-12 21:41 | 0 | |
![[SND]](/icons/sound2.gif) | DARK1.mp3 | 2022-08-12 21:40 | 0 | |
![[SND]](/icons/sound2.gif) | Matre-gims-bella_[www.Bisyor.me].mp3 | 2022-08-12 21:36 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-show-club-remix.mp3 | 2022-08-12 21:33 | 0 | |
![[SND]](/icons/sound2.gif) | Morgenshtern_Show_Sever_remix.mp3 | 2022-08-12 21:31 | 0 | |
![[SND]](/icons/sound2.gif) | Adam Lapierre Director of Wine Vint.mp3 | 2022-08-12 21:27 | 184K | |
![[SND]](/icons/sound2.gif) | VK.mp3 | 2022-08-12 21:25 | 2.4M | |
![[SND]](/icons/sound2.gif) | RR (1).mp3 | 2022-08-12 21:23 | 0 | |
![[SND]](/icons/sound2.gif) | Anthony Zhang, Vinovest Cofounder CEO answering What has made whiskey one of the best-performing assets of 2022.mp3 | 2022-08-12 21:14 | 0 | |
![[SND]](/icons/sound2.gif) | JOMBLO2.mp3 | 2022-08-12 21:13 | 4.0K | |
![[SND]](/icons/sound2.gif) | The Cad.mp3 | 2022-08-12 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | Armağan Oruç - Gun Double.mp3 | 2022-08-12 20:58 | 0 | |
![[SND]](/icons/sound2.gif) | Мурат Тхагалегов - Чужая невеста (mp3store.cc).mp3 | 2022-08-12 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | DINOAZ-1.mp3 | 2022-08-12 20:54 | 0 | |
![[SND]](/icons/sound2.gif) | Барбарики - PHONK REMIX (mp3-2020.com).mp3 | 2022-08-12 20:53 | 1.1M | |
![[SND]](/icons/sound2.gif) | DINO_AZ1.mp3 | 2022-08-12 20:51 | 0 | |
![[SND]](/icons/sound2.gif) | Duki - GIVENCHY x Hello Cotto ( Mashup ) ( DJ Hummer Remix ) .mp3 | 2022-08-12 20:44 | 0 | |
![[SND]](/icons/sound2.gif) | faydademo.mp3 | 2022-08-12 20:43 | 0 | |
![[SND]](/icons/sound2.gif) | Over_the_Horizon.mp3 | 2022-08-12 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | PlayaPhonk_-_Phonky_Town_72969550.mp3 | 2022-08-12 20:33 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV_Noh_-_Disaster_73210675.mp3 | 2022-08-12 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | KSLV_Noh_-_Override_slowed_reverb_74103963.mp3 | 2022-08-12 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | Jxid1.mp3 | 2022-08-12 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | DISASTER_-_KSLV_Noh_slowed_reverb_320_kbps_73321634.mp3 | 2022-08-12 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | MyBe1.mp3 | 2022-08-12 20:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lil Uzi Vert 20 Min.mp3 | 2022-08-12 20:24 | 0 | |
![[SND]](/icons/sound2.gif) | Snoop_Dogg_Dr_Dre_-_Still_DRE_47964903.mp3 | 2022-08-12 20:23 | 10M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Playboi Carti Sky Official Audio.mp3 | 2022-08-12 20:22 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Azik - Chuchuka (mp3store.cc).mp3 | 2022-08-12 20:21 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Azik - Chuchuka (mp3store.cc) (1).mp3 | 2022-08-12 20:19 | 0 | |
![[VID]](/icons/movie.gif) | audioclip-1659980429000-81000.mp4 | 2022-08-12 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | vincent.mp3 | 2022-08-12 20:18 | 0 | |
![[SND]](/icons/sound2.gif) | danzakudurox.mp3 | 2022-08-12 20:11 | 0 | |
![[SND]](/icons/sound2.gif) | CuihX1.mp3 | 2022-08-12 20:10 | 0 | |
![[SND]](/icons/sound2.gif) | Три дня дождя - Неважно_(tropicmusic.ru).mp3 | 2022-08-12 20:08 | 0 | |
![[SND]](/icons/sound2.gif) | HayukLagu1.mp3 | 2022-08-12 20:07 | 0 | |
![[SND]](/icons/sound2.gif) | bili.mp3 | 2022-08-12 20:05 | 0 | |
![[SND]](/icons/sound2.gif) | MpE1.mp3 | 2022-08-12 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | iniperludienter1 mp3_13-08-22_03-44-05-234.mp3 | 2022-08-12 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Три дня дождя - Неважно.mp3 | 2022-08-12 19:58 | 0 | |
![[SND]](/icons/sound2.gif) | yoreyes1.mp3 | 2022-08-12 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Don-Omar-feat-Tego-Calderon_-_Bandaleros-ost-Troynoy-forsazh-Tokiyskiy-drift_(mp3home.me).mp3 | 2022-08-12 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | sasa.mp3 | 2022-08-12 19:44 | 0 | |
![[SND]](/icons/sound2.gif) | sasa1.mp3 | 2022-08-12 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | Sokin1.mp3 | 2022-08-12 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - YG Toxic_320kbps.mp3 | 2022-08-12 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | rub.mp3 | 2022-08-12 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | Aa.mp3 | 2022-08-12 19:32 | 7.3M | |
![[SND]](/icons/sound2.gif) | Aranc Qez.mp3 | 2022-08-12 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220812-WA0017.m4a | 2022-08-12 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | master.mp3 | 2022-08-12 19:27 | 0 | |
![[SND]](/icons/sound2.gif) | palak1.mp3 | 2022-08-12 19:26 | 0 | |
![[SND]](/icons/sound2.gif) | Byansi by Collins.mp3 | 2022-08-12 19:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | collins- hellen mastered[HMRecords]0753486667.mp3 | 2022-08-12 19:23 | 0 | |
![[SND]](/icons/sound2.gif) | ℂ𝕦𝕓𝕒𝕖𝕤𝕤-🎟-kissvk.com.mp3 | 2022-08-12 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | sentimental.mp3 | 2022-08-12 19:21 | 0 | |
![[SND]](/icons/sound2.gif) | Yoi1.mp3 | 2022-08-12 19:20 | 0 | |
![[SND]](/icons/sound2.gif) | BetterDays.mp3 | 2022-08-12 19:19 | 4.6M | |
![[SND]](/icons/sound2.gif) | LostSky.mp3 | 2022-08-12 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | Breezeblocks.mp3 | 2022-08-12 19:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dark_Souls_OST_-_Sif_velikij_volk_(Gybka.com).mp3 | 2022-08-12 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | Alt-J (∆) _ Breezeblocks Lyrics (HQ).mp3 | 2022-08-12 19:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIL1.mp3 | 2022-08-12 19:12 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije2.mp3 | 2022-08-12 19:11 | 3.9M | |
![[SND]](/icons/sound2.gif) | Sok3.mp3 | 2022-08-12 19:09 | 0 | |
![[SND]](/icons/sound2.gif) | Sok2.mp3 | 2022-08-12 19:04 | 0 | |
![[SND]](/icons/sound2.gif) | selamatulangtahun.mp3 | 2022-08-12 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | Sokin2.mp3 | 2022-08-12 19:02 | 0 | |
![[SND]](/icons/sound2.gif) | MaMu2.mp3 | 2022-08-12 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | IUIH.mp3 | 2022-08-12 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | lucifer_call_me_devil.mp3 | 2022-08-12 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | TryMitis.mp3 | 2022-08-12 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | lucifer_call_me_devil_-5547512551233268271.mp3 | 2022-08-12 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | Vr.mp3 | 2022-08-12 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | Gustixa_-_lemon_tree(256k).mp3 | 2022-08-12 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | 7063826647098641178.mp3 | 2022-08-12 18:39 | 0 | |
![[SND]](/icons/sound2.gif) | D GERRARD - นักวิทยาศาสตร์ (Scientist) (Lyrics).mp3 | 2022-08-12 18:38 | 0 | |
![[SND]](/icons/sound2.gif) | lukku11.mp3 | 2022-08-12 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Gellen Martadinata Selamat Ulang Tahun cover by Moyy.mp3 | 2022-08-12 18:37 | 0 | |
![[SND]](/icons/sound2.gif) | yt.mp3 | 2022-08-12 18:35 | 0 | |
![[SND]](/icons/sound2.gif) | !positive.mp3 | 2022-08-12 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-so-icy-nihao-file.mp3 | 2022-08-12 18:29 | 0 | |
![[SND]](/icons/sound2.gif) | b13ftw.mp3 | 2022-08-12 18:26 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA1.mp3 | 2022-08-12 18:25 | 424K | |
![[VID]](/icons/movie.gif) | Cukup Dikenang Saja.mp4 | 2022-08-12 18:22 | 0 | |
![[SND]](/icons/sound2.gif) | DuaLipa.mp3 | 2022-08-12 18:18 | 0 | |
![[SND]](/icons/sound2.gif) | Платина feat OG Buda, MAYOT - Abu Dhabi Ba6y.mp3 | 2022-08-12 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | 1234.mp3 | 2022-08-12 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | 50.mp3 | 2022-08-12 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | 123.mp3 | 2022-08-12 18:15 | 2.4M | |
![[SND]](/icons/sound2.gif) | 100.mp3 | 2022-08-12 18:15 | 3.3M | |
![[SND]](/icons/sound2.gif) | 111.mp3 | 2022-08-12 18:15 | 2.0M | |
![[SND]](/icons/sound2.gif) | 31.mp3 | 2022-08-12 18:14 | 1.5M | |
![[SND]](/icons/sound2.gif) | 29.mp3 | 2022-08-12 18:14 | 2.4M | |
![[SND]](/icons/sound2.gif) | 24.mp3 | 2022-08-12 18:14 | 144K | |
![[SND]](/icons/sound2.gif) | 25.mp3 | 2022-08-12 18:14 | 1.0M | |
![[SND]](/icons/sound2.gif) | 28.mp3 | 2022-08-12 18:14 | 2.0M | |
![[SND]](/icons/sound2.gif) | 26.mp3 | 2022-08-12 18:13 | 1.7M | |
![[SND]](/icons/sound2.gif) | 9.mp3 | 2022-08-12 18:13 | 2.4M | |
![[SND]](/icons/sound2.gif) | Whistle.mp3 | 2022-08-12 18:13 | 4.0M | |
![[SND]](/icons/sound2.gif) | Youth.mp3 | 2022-08-12 18:13 | 3.1M | |
![[SND]](/icons/sound2.gif) | 0.mp3 | 2022-08-12 18:13 | 524K | |
![[SND]](/icons/sound2.gif) | Things.mp3 | 2022-08-12 18:13 | 4.3M | |
![[SND]](/icons/sound2.gif) | Tsinelas.mp3 | 2022-08-12 18:12 | 3.0M | |
![[SND]](/icons/sound2.gif) | Sweater.mp3 | 2022-08-12 18:12 | 4.3M | |
![[SND]](/icons/sound2.gif) | Stig.mp3 | 2022-08-12 18:12 | 4.8M | |
![[SND]](/icons/sound2.gif) | Thankyou.mp3 | 2022-08-12 18:12 | 3.4M | |
![[SND]](/icons/sound2.gif) | Theway.mp3 | 2022-08-12 18:12 | 2.8M | |
![[SND]](/icons/sound2.gif) | TeleportMe.mp3 | 2022-08-12 18:11 | 2.7M | |
![[SND]](/icons/sound2.gif) | Talk.mp3 | 2022-08-12 18:11 | 2.9M | |
![[SND]](/icons/sound2.gif) | slowly.mp3 | 2022-08-12 18:11 | 2.7M | |
![[SND]](/icons/sound2.gif) | Pogi.mp3 | 2022-08-12 18:11 | 4.1M | |
![[SND]](/icons/sound2.gif) | Staywithme.mp3 | 2022-08-12 18:11 | 1.9M | |
![[SND]](/icons/sound2.gif) | Peekaboo.mp3 | 2022-08-12 18:10 | 3.7M | |
![[SND]](/icons/sound2.gif) | PSG.mp3 | 2022-08-12 18:10 | 2.8M | |
![[SND]](/icons/sound2.gif) | Pahina.mp3 | 2022-08-12 18:10 | 5.2M | |
![[SND]](/icons/sound2.gif) | perfect.mp3 | 2022-08-12 18:10 | 2.3M | |
![[SND]](/icons/sound2.gif) | Own.mp3 | 2022-08-12 18:10 | 3.9M | |
![[SND]](/icons/sound2.gif) | Norem.mp3 | 2022-08-12 18:09 | 4.2M | |
![[SND]](/icons/sound2.gif) | Payday.mp3 | 2022-08-12 18:09 | 2.6M | |
![[SND]](/icons/sound2.gif) | Orasna.mp3 | 2022-08-12 18:09 | 2.6M | |
![[SND]](/icons/sound2.gif) | OneVoice.mp3 | 2022-08-12 18:09 | 2.5M | |
![[SND]](/icons/sound2.gif) | Letme.mp3 | 2022-08-12 18:09 | 3.5M | |
![[SND]](/icons/sound2.gif) | Loki.mp3 | 2022-08-12 18:09 | 2.9M | |
![[SND]](/icons/sound2.gif) | Kontrabida.mp3 | 2022-08-12 18:09 | 5.1M | |
![[SND]](/icons/sound2.gif) | Night.mp3 | 2022-08-12 18:08 | 2.8M | |
![[SND]](/icons/sound2.gif) | Nasasanay.mp3 | 2022-08-12 18:08 | 5.3M | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kari.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | Me.mp3 | 2022-08-12 18:08 | 3.9M | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-99-problems.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | jamik-samolet-mp3.mp3 | 2022-08-12 18:08 | 0 | |
![[SND]](/icons/sound2.gif) | marceline.mp3 | 2022-08-12 18:08 | 2.4M | |
![[SND]](/icons/sound2.gif) | Kings.mp3 | 2022-08-12 18:08 | 2.5M | |
![[SND]](/icons/sound2.gif) | Jamik_feat_ARCHI_Kupyury (1).mp3 | 2022-08-12 18:07 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA2.mp3 | 2022-08-12 18:06 | 0 | |
![[SND]](/icons/sound2.gif) | big-baby-tape-kizaru-dirrt.mp3 | 2022-08-12 18:05 | 0 | |
![[SND]](/icons/sound2.gif) | omda1 (2).mp3 | 2022-08-12 18:03 | 0 | |
![[SND]](/icons/sound2.gif) | par.mp3 | 2022-08-12 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | happy Birthday versi BT21🤗😂 #bt21🙏#hutri75.mp3 | 2022-08-12 17:59 | 4.0M | |
![[SND]](/icons/sound2.gif) | gor.mp3 | 2022-08-12 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | ABBA - Mamma Mia (Jason Kokkovas Pop Punk cover).mp3 | 2022-08-12 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | DJ BBHC PYRAMID SLOWED VIRAL TIKTOK (1).mp3 | 2022-08-12 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | Onda Cero Entrevista 12 de agosto.mp3 | 2022-08-12 17:52 | 2.9M | |
![[SND]](/icons/sound2.gif) | taek.mp3 | 2022-08-12 17:50 | 233K | |
![[SND]](/icons/sound2.gif) | g6.mp3 | 2022-08-12 17:47 | 3.9M | |
![[SND]](/icons/sound2.gif) | เพลง.mp3 | 2022-08-12 17:41 | 0 | |
![[SND]](/icons/sound2.gif) | muli.mp3.mp3 | 2022-08-12 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | RAY.mp3 | 2022-08-12 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | Slava Marlow - Camry 3.5 (Right Version) ♂Gachi Remix♂ prod.Rat TV (ПЕРЕЗАЛИВ).mp3 | 2022-08-12 17:34 | 824K | |
![[SND]](/icons/sound2.gif) | ROGDJ.mp3 | 2022-08-12 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | Anime_de_Japan_Torn_Apart_Bleach_OST_S_5Fn103TaY_3cef74cf.mp3 | 2022-08-12 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | tpast.mp3.mp3 | 2022-08-12 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | svt.mp3 | 2022-08-12 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | TOBA4.mp3 | 2022-08-12 17:29 | 3.1M | |
![[VID]](/icons/movie.gif) | yt1s.com - غير وحدي مدمر نبغي نسكر عليها نهدر.mp4 | 2022-08-12 17:28 | 0 | |
![[SND]](/icons/sound2.gif) | ROG105.mp3 | 2022-08-12 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | Tun.mp3 | 2022-08-12 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | 3 Daqat - Abu Ft. Yousra ثلاث دقات - أبو و يسرا[Mpgun.com].mp3 | 2022-08-12 17:23 | 0 | |
![[SND]](/icons/sound2.gif) | wibuu.mp3 | 2022-08-12 17:22 | 0 | |
![[SND]](/icons/sound2.gif) | bilel laabidi - Sebt w lahad( rap tounsi ) الغناية الحدث 😂😂 [Mpgun.com].mp3 | 2022-08-12 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Last Child - DUKA (Official Lyric Video).mp3 | 2022-08-12 17:17 | 644K | |
![[SND]](/icons/sound2.gif) | Z9.mp3 | 2022-08-12 17:17 | 4.0M | |
![[SND]](/icons/sound2.gif) | face-yumorist-mp3.mp3 | 2022-08-12 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Techno Ibiza 12-08-202WTF2 10-44.mp3 | 2022-08-12 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Ungu1.mp3 | 2022-08-12 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | luffy2.mp3 | 2022-08-12 17:11 | 0 | |
![[SND]](/icons/sound2.gif) | H2.mp3 | 2022-08-12 17:10 | 3.9M | |
![[SND]](/icons/sound2.gif) | Galau duka.mp3 | 2022-08-12 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | Dj4.mp3 | 2022-08-12 17:10 | 1.2M | |
![[SND]](/icons/sound2.gif) | TOBA.mp3 | 2022-08-12 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | luffy3.mp3 | 2022-08-12 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | Why This Kolaveri Di Dhanush 320kbps.mp3 | 2022-08-12 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | legoislandbuggy.mp3 | 2022-08-12 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | Lagnalu 2.0 Dj Govinda GR.mp3 | 2022-08-12 17:04 | 0 | |
![[SND]](/icons/sound2.gif) | k4.mp3 | 2022-08-12 17:01 | 4.0M | |
![[SND]](/icons/sound2.gif) | Payphone1.mp3 | 2022-08-12 16:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | Пицца - Фары.mp3 | 2022-08-12 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | DAVA & Kara Kross - Бум шакалака.mp3 | 2022-08-12 16:54 | 0 | |
![[SND]](/icons/sound2.gif) | as3.mp3 | 2022-08-12 16:53 | 3.6M | |
![[SND]](/icons/sound2.gif) | Swagging.mp3 | 2022-08-12 16:52 | 0 | |
![[SND]](/icons/sound2.gif) | Ghostface_Playa_-_Swaggin'_at_the_Partment(128k).mp3 | 2022-08-12 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | Rave.mp3 | 2022-08-12 16:49 | 2.4M | |
![[SND]](/icons/sound2.gif) | k2.mp3 | 2022-08-12 16:47 | 4.0M | |
![[SND]](/icons/sound2.gif) | Baumwolle-Max-D-Murf.mp3 | 2022-08-12 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | Cheb Mourad - Yahsarah Ki Kounti Tebghini يا حصراه مين كنتي تبغيني (Slowed Reverb)(MP3_128K).mp3 | 2022-08-12 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | Baumwolle-Lukas-Talkia.mp3 | 2022-08-12 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | badass.mp3 | 2022-08-12 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | c1.mp3 | 2022-08-12 16:33 | 4.8M | |
![[SND]](/icons/sound2.gif) | Monster Ending 2 Make it home.mp3 | 2022-08-12 16:28 | 0 | |
![[SND]](/icons/sound2.gif) | ytmp3free.cc_uvi-pozdrav-brate-youtubemp3free.org.mp3 | 2022-08-12 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | MIDNIGHT.mp3 | 2022-08-12 16:24 | 0 | |
![[SND]](/icons/sound2.gif) | anto23.mp3 | 2022-08-12 16:24 | 1.3M | |
![[SND]](/icons/sound2.gif) | Further West Presents The Blank Tapes Cherry Girl Live at Raven Sound Studio.mp3 | 2022-08-12 16:22 | 3.1M | |
![[SND]](/icons/sound2.gif) | Dhije1.mp3 | 2022-08-12 16:18 | 0 | |
![[SND]](/icons/sound2.gif) | proemquen.mp3 | 2022-08-12 16:17 | 0 | |
![[SND]](/icons/sound2.gif) | แว้นฟอร์มช่าง- 90s Supply (official MV) (1).mp3 | 2022-08-12 16:12 | 0 | |
![[SND]](/icons/sound2.gif) | Lesha_Svik_Malinoviy.mp3 | 2022-08-12 16:11 | 1.1M | |
![[SND]](/icons/sound2.gif) | 2021 YEAR END MASHUP - SUSH & YOHAN (BEST 130+ SONGS OF 2021).mp3 | 2022-08-12 16:07 | 11M | |
![[SND]](/icons/sound2.gif) | Ghostface.m4a | 2022-08-12 16:07 | 1.9M | |
![[SND]](/icons/sound2.gif) | Let Me Down Slowly x Kabhi Jo Badal Barse (Mashup) Alec Benjamin, Arijit Singh oddKidd.mp3 | 2022-08-12 16:06 | 2.8M | |
![[SND]](/icons/sound2.gif) | Petta - Marana Mass Official Video (Tamil) Rajinikanth Anirudh Ravichander.mp3 | 2022-08-12 16:06 | 3.2M | |
![[SND]](/icons/sound2.gif) | wes.mp3 | 2022-08-12 16:03 | 4.2M | |
![[SND]](/icons/sound2.gif) | Mugen Train Ost - Akaza vs Rengoku.mp3 | 2022-08-12 16:01 | 19M | |
![[SND]](/icons/sound2.gif) | anhky.mp3 | 2022-08-12 16:01 | 3.7M | |
![[SND]](/icons/sound2.gif) | Beeping.mp3 | 2022-08-12 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | Playa7.mp3 | 2022-08-12 15:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sick.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | Playaa.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | Playa.mp3 | 2022-08-12 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | chay.mp3 | 2022-08-12 15:57 | 0 | |
![[SND]](/icons/sound2.gif) | DJ KU HAMIL DULUAN SUDAH 3 BULAN SOUND USAT PINT VIRAL FYP TIKTOK.mp3 | 2022-08-12 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | Beach Bunny - Prom Queen (Official Video).mp3 | 2022-08-12 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | pristine2.mp3 | 2022-08-12 15:51 | 0 | |
![[SND]](/icons/sound2.gif) | total.mp3 | 2022-08-12 15:51 | 37M | |
![[SND]](/icons/sound2.gif) | Aunt.mp3 | 2022-08-12 15:49 | 0 | |
![[SND]](/icons/sound2.gif) | INDRI.mp3 | 2022-08-12 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | cj1.mp3 | 2022-08-12 15:47 | 0 | |
![[VID]](/icons/movie.gif) | tan2.mp4 | 2022-08-12 15:46 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno.mp3 | 2022-08-12 15:46 | 3.9M | |
![[SND]](/icons/sound2.gif) | Queen.mp3 | 2022-08-12 15:45 | 2.1M | |
![[SND]](/icons/sound2.gif) | Am1.mp3 | 2022-08-12 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | ejay2.mp3 | 2022-08-12 15:44 | 0 | |
![[SND]](/icons/sound2.gif) | memek.mp3 | 2022-08-12 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | Sn.Mp.mp3 | 2022-08-12 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | sino.mp3 | 2022-08-12 15:40 | 0 | |
![[SND]](/icons/sound2.gif) | requestsino.mp3 | 2022-08-12 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - Jake Hill - dying lately (Full Album) (128 kbps).mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | the best Ukrainian songs - BUSHIDO ZHO - Водила чувствует мой вайб.mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | UNIQUE.mp3 | 2022-08-12 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | Nerve.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | Кореш feat. treepside - Толпа.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | pristine.mp3 | 2022-08-12 15:36 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta.mp3 | 2022-08-12 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | Beep.mp3 | 2022-08-12 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | kavabanga Depo kolibri - Рассвело.mp3 | 2022-08-12 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | Kolaveri D-Cypher -- (Sush _ Yohan Mashup)(MP3_128K).mp3 | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | miku.mp3 | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | sheesh.m4a | 2022-08-12 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fnatylqrd - Fed up..mp3 | 2022-08-12 15:30 | 0 | |
![[SND]](/icons/sound2.gif) | BANGSAD.mp3 | 2022-08-12 15:22 | 1.9M | |
![[SND]](/icons/sound2.gif) | crush.mp3 | 2022-08-12 15:22 | 3.3M | |
![[SND]](/icons/sound2.gif) | Jake_Hill_-_Stay_(Prod._CXDY)(256k).mp3 | 2022-08-12 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | LAKEY INSPIRED - Chill Day.mp3 | 2022-08-12 15:17 | 0 | |
![[SND]](/icons/sound2.gif) | SAD.mp3 | 2022-08-12 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | jo92.mp3 | 2022-08-12 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | Narzzpro5.mp3 | 2022-08-12 15:09 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - nerve (Lyrics).mp3 | 2022-08-12 15:07 | 2.7M | |
![[SND]](/icons/sound2.gif) | law.mp3 | 2022-08-12 15:07 | 0 | |
![[SND]](/icons/sound2.gif) | MARNIK x Alfons x Pule - Harry Potter Style (Lyrics Video).mp3 | 2022-08-12 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | Sino.mp3 | 2022-08-12 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dandelions_-_Ruth_B_(Lyrics_+_Slow_Version)(256k).mp3 | 2022-08-12 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | Kendrick Lamar.mp3 | 2022-08-12 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | trees.mp3 | 2022-08-12 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | alan.mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | zaebispizdato.mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - Follow Me Into Hell (EP).mp3 | 2022-08-12 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jake Hill - Hiding in the Dark.mp3 | 2022-08-12 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | fdsfsdf.mp3 | 2022-08-12 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | 1636722837_imagine-dragons-enemy-from-the-series-arcane-league-of-legends.mp3 | 2022-08-12 14:59 | 0 | |
![[SND]](/icons/sound2.gif) | y.mp3 | 2022-08-12 14:58 | 104K | |
![[SND]](/icons/sound2.gif) | Anrufbeantworter einer Irrenanstalt.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | Tik.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | yon.mp3 | 2022-08-12 14:57 | 0 | |
![[SND]](/icons/sound2.gif) | unnv-muza-mp3.mp3 | 2022-08-12 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | iLOVEFRiDAY-Mia-Khalifa.mp3 | 2022-08-12 14:55 | 804K | |
![[SND]](/icons/sound2.gif) | sed.mp3 | 2022-08-12 14:54 | 950K | |
![[SND]](/icons/sound2.gif) | Dj Mbon.mp3 | 2022-08-12 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Lin.mp3 | 2022-08-12 14:52 | 0 | |
![[SND]](/icons/sound2.gif) | Sickomode.mp3 | 2022-08-12 14:52 | 1.2M | |
![[SND]](/icons/sound2.gif) | tom.mp3 | 2022-08-12 14:51 | 1.6M | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1).mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1) (1).mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - Missчик.`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | #Ắί₭Ǿ♫ - Дежавю.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - cексуально. `_.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - 86868.`__.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - Ба ба ба._`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - _.`.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - ⲋⲉⲭ ʀⲉⲙⲓⲭ 🕊️.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - cause you are.` _.mp3 | 2022-08-12 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | - у меня в планах забрать тебя.`.mp3 | 2022-08-12 14:50 | 3.4M | |
![[SND]](/icons/sound2.gif) | sdhbet.mp3 | 2022-08-12 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | Bf.mp3 | 2022-08-12 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | hatt.mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | - - Corvette' (slow).mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | BASS CLUB (автозвук) - Громкий фронт 323.mp3 | 2022-08-12 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | (29)Migos - Racks 2 Skinny(Screwed By Artem).mp3 | 2022-08-12 14:44 | 0 | |
![[SND]](/icons/sound2.gif) | Growna.mp3.mp3 | 2022-08-12 14:43 | 1.5M | |
![[SND]](/icons/sound2.gif) | bubble.mp3 | 2022-08-12 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | Lena_Raine_-_Pigstep_Minecraft_OST_69258249.mp3 | 2022-08-12 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Growna1.mp3 | 2022-08-12 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | fukiangga.mp3 | 2022-08-12 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | anggakul.mp3 | 2022-08-12 14:27 | 0 | |
![[SND]](/icons/sound2.gif) | Teger.mp3 | 2022-08-12 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | b128453d3e6881d692e2ca81d1d3c94d.mp3 | 2022-08-12 14:24 | 0 | |
![[SND]](/icons/sound2.gif) | loginmusic.mp3 | 2022-08-12 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | GR 1.MP3.mp3 | 2022-08-12 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | link.mp3 | 2022-08-12 14:21 | 3.4M | |
![[SND]](/icons/sound2.gif) | twerk.mp3 | 2022-08-12 14:17 | 0 | |
![[SND]](/icons/sound2.gif) | djmerahh.mp3 | 2022-08-12 14:16 | 0 | |
![[SND]](/icons/sound2.gif) | luffy.mp3 | 2022-08-12 14:14 | 3.0M | |
![[SND]](/icons/sound2.gif) | Chekele(PagalWorld).mp3 | 2022-08-12 14:13 | 0 | |
![[SND]](/icons/sound2.gif) | beast.mp3 | 2022-08-12 14:13 | 2.6M | |
![[SND]](/icons/sound2.gif) | Maid Dress GR.mp3 | 2022-08-12 14:13 | 0 | |
![[SND]](/icons/sound2.gif) | vortex1.mp3 | 2022-08-12 14:10 | 324K | |
![[SND]](/icons/sound2.gif) | Z6.mp3 | 2022-08-12 14:06 | 3.6M | |
![[SND]](/icons/sound2.gif) | Z1.mp3 | 2022-08-12 14:06 | 0 | |
![[SND]](/icons/sound2.gif) | tyes.mp3 | 2022-08-12 14:05 | 248K | |
![[SND]](/icons/sound2.gif) | Z5.mp3 | 2022-08-12 14:05 | 4.8M | |
![[SND]](/icons/sound2.gif) | Z4.mp3 | 2022-08-12 14:05 | 3.6M | |
![[SND]](/icons/sound2.gif) | Sannztuy.mp3 | 2022-08-12 14:05 | 1.7M | |
![[SND]](/icons/sound2.gif) | Z3.mp3 | 2022-08-12 14:05 | 2.4M | |
![[SND]](/icons/sound2.gif) | Z2.mp3 | 2022-08-12 14:05 | 4.1M | |
![[SND]](/icons/sound2.gif) | ASIKINbre.mp3 | 2022-08-12 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | anton.mp3 | 2022-08-12 14:02 | 344K | |
![[SND]](/icons/sound2.gif) | applee.mp3 | 2022-08-12 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Kesariya.mp3 | 2022-08-12 14:01 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno_Mars_-_It_Will_Rain_(Official_Music_Video)(128k).mp3 | 2022-08-12 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhijehh.mp3 | 2022-08-12 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | thanhak.mp3 | 2022-08-12 13:58 | 0 | |
![[SND]](/icons/sound2.gif) | regge.mp3 | 2022-08-12 13:58 | 0 | |
![[SND]](/icons/sound2.gif) | santuybngst.mp3 | 2022-08-12 13:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ravicks1.mp3 | 2022-08-12 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | chifu.mp3 | 2022-08-12 13:55 | 0 | |
![[SND]](/icons/sound2.gif) | Ska.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze4.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze6.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze5.mp3 | 2022-08-12 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Ze2.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | KAMPANGGG.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | ZE1.mp3 | 2022-08-12 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | ASUI.mp3 | 2022-08-12 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | p3.mp3 | 2022-08-12 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | Jin_Dogg_街風_feat_REAL_T_Official_Music_Vi.mp3 | 2022-08-12 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | gta.mp3 | 2022-08-12 13:43 | 136K | |
![[SND]](/icons/sound2.gif) | astrea redux - timemachine [audiovk.com].mp3 | 2022-08-12 13:43 | 0 | |
![[SND]](/icons/sound2.gif) | A8.mp3 | 2022-08-12 13:42 | 0 | |
![[SND]](/icons/sound2.gif) | marcin_przybyowicz_-_a_story_you_wont_believe_(z2.fm).mp3 | 2022-08-12 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | PANTEK.mp3 | 2022-08-12 13:38 | 0 | |
![[VID]](/icons/movie.gif) | 25145f62246bde9491eca32dde3e42dc.mp4 | 2022-08-12 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | Caham.mp3 | 2022-08-12 13:36 | 0 | |
![[SND]](/icons/sound2.gif) | dj13.mp3 | 2022-08-12 13:36 | 0 | |
![[SND]](/icons/sound2.gif) | ASUII.mp3 | 2022-08-12 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | andrewsad.mp3 | 2022-08-12 13:28 | 0 | |
![[SND]](/icons/sound2.gif) | toto.mp3 | 2022-08-12 13:26 | 3.0M | |
![[SND]](/icons/sound2.gif) | X2Download.com - Versi koplo Viral TikTok Okey Are you Ready lagu Thailand wong e e e e e wong e e e e e (128 kbps).mp3 | 2022-08-12 13:26 | 3.7M | |
![[SND]](/icons/sound2.gif) | za3im.mp3 | 2022-08-12 13:25 | 2.9M | |
![[SND]](/icons/sound2.gif) | Geoxor_-_Aurora_(Byfet.com).mp3 | 2022-08-12 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | Y0VNG ZXR0 - Yandere ft. Ambi (Prod. Bughvvl)-1.mp3 | 2022-08-12 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | YUNG-RARE _ KXLLSWXTCH ☢️ - TALIBAN DEADBEATVILLAIN.mp3 | 2022-08-12 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | Lyova_Vlax_-_A_edet_katitsya_zanijena_priora.mp3 | 2022-08-12 13:22 | 0 | |
![[SND]](/icons/sound2.gif) | Pop Smoke - Get Back (mp3store.cc).mp3 | 2022-08-12 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | Skirii1.mp3 | 2022-08-12 13:18 | 0 | |
![[SND]](/icons/sound2.gif) | vortex.mp3 | 2022-08-12 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | GeorgeM1.mp3 | 2022-08-12 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | POROJO.mp3 | 2022-08-12 13:14 | 0 | |
![[SND]](/icons/sound2.gif) | Galauu18.mp3 | 2022-08-12 13:14 | 0 | |
![[SND]](/icons/sound2.gif) | Dennz.mp3 | 2022-08-12 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | DAY DAY.mp3 | 2022-08-12 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | Pop Smoke - Get Back.mp3 | 2022-08-12 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | $uicideboy$ - Fuck Boy Blood Bath.mp3 | 2022-08-12 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | Chinx (OS) - Secrets Not Safe.mp3 | 2022-08-12 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | Ssinar.mp3 | 2022-08-12 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | intheend.mp3 | 2022-08-12 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Sinar.mp3 | 2022-08-12 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | DJ GODZILLA V2 SLOW REMIX viral FYP tiktok 2022🎶🎧.mp3 | 2022-08-12 12:59 | 0 | |
![[SND]](/icons/sound2.gif) | bodiev-kruzak-200-remix.mp3 | 2022-08-12 12:58 | 0 | |
![[SND]](/icons/sound2.gif) | Beach Bunny - Prom Queen (Speed Up) lyrics 🎶.mp3 | 2022-08-12 12:56 | 0 | |
![[SND]](/icons/sound2.gif) | 1..mp3 | 2022-08-12 12:56 | 0 | |
![[SND]](/icons/sound2.gif) | psovsk.mp3 | 2022-08-12 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | Kandas15.mp3 | 2022-08-12 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | ai_papai.mp3 | 2022-08-12 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | Pesnya_Moj_drug_ms_bombil_tolko_legalno.mp3 | 2022-08-12 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Thinkdi.mp3 | 2022-08-12 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | Shincan.mp3 | 2022-08-12 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | until faond.mp3 | 2022-08-12 12:45 | 0 | |
![[SND]](/icons/sound2.gif) | oky.mp3 | 2022-08-12 12:38 | 0 | |
![[SND]](/icons/sound2.gif) | dan.mp3 | 2022-08-12 12:34 | 0 | |
![[SND]](/icons/sound2.gif) | kane.mp3 | 2022-08-12 12:33 | 2.8M | |
![[SND]](/icons/sound2.gif) | akankah.mp3 | 2022-08-12 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Romantic Happy Birthday Arranged by Miranda Wong Piano Cover.mp3 | 2022-08-12 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | A_cyplenok_pi-pi-piu_-_A_u_nas_zhivet_cyplenok_(iPleer.com).mp3 | 2022-08-12 12:26 | 0 | |
![[SND]](/icons/sound2.gif) | Ghostemane - Bonesaw.mp3 | 2022-08-12 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | vikram.mp3 | 2022-08-12 12:22 | 2.3M | |
![[SND]](/icons/sound2.gif) | iop.mp3 | 2022-08-12 12:22 | 0 | |
![[SND]](/icons/sound2.gif) | kal.mp3 | 2022-08-12 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | zxc.mp3 | 2022-08-12 12:17 | 728K | |
![[SND]](/icons/sound2.gif) | omda2.mp3 | 2022-08-12 12:15 | 628K | |
![[SND]](/icons/sound2.gif) | fivem.mp3 | 2022-08-12 12:13 | 92K | |
![[SND]](/icons/sound2.gif) | V-$-XV-PRiNCE_De_Lacure-Jyrigimdi.mp3 | 2022-08-12 12:02 | 1.3M | |
![[SND]](/icons/sound2.gif) | memay.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | DhikaSad8.MP.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa8.mp3 | 2022-08-12 12:01 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa3.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa2.mp3 | 2022-08-12 12:00 | 4.0M | |
![[SND]](/icons/sound2.gif) | Dhikaa5.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa7.mp3 | 2022-08-12 12:00 | 0 | |
![[SND]](/icons/sound2.gif) | god.mp3 | 2022-08-12 11:59 | 16K | |
![[SND]](/icons/sound2.gif) | V $ X V PRiNCE, De Lacure - Жүрегімді.mp3 | 2022-08-12 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | BO.mp3 | 2022-08-12 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | Bakr_-_Status_dushi_73037819.mp3 | 2022-08-12 11:53 | 6.9M | |
![[SND]](/icons/sound2.gif) | KO.mp3 | 2022-08-12 11:53 | 1.1M | |
![[SND]](/icons/sound2.gif) | Mahika.mp3.mp3 | 2022-08-12 11:50 | 2.5M | |
![[SND]](/icons/sound2.gif) | MO.mp3 | 2022-08-12 11:50 | 4.6M | |
![[SND]](/icons/sound2.gif) | sex.mp3 | 2022-08-12 11:49 | 1.8M | |
![[SND]](/icons/sound2.gif) | TVアニメ『サクラクエスト』ノンクレジットOP/「Morning Glory」(K)NoW_NAME.mp3 | 2022-08-12 11:48 | 0 | |
![[SND]](/icons/sound2.gif) | omda3.mp3 | 2022-08-12 11:43 | 1.7M | |
![[SND]](/icons/sound2.gif) | KIRYa_NASVAEV_Matiz.mp3 | 2022-08-12 11:42 | 1.1M | |
![[SND]](/icons/sound2.gif) | loveuna.mp3 | 2022-08-12 11:41 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rizkyfebian Selamat Ulang tahun Lyrics.mp3 | 2022-08-12 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | odium.mp3 | 2022-08-12 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | km.mp3 | 2022-08-12 11:35 | 2.4M | |
![[SND]](/icons/sound2.gif) | lop.mp3 | 2022-08-12 11:34 | 0 | |
![[SND]](/icons/sound2.gif) | ______.mp3 | 2022-08-12 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | Pik - Güzelsin (Turkish Trap)333.mp3 | 2022-08-12 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | Shincandj.mp3 | 2022-08-12 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | Dr.Fresch_ Mina Knock _-_ Feedback_ -_ Feedback1.mp3 | 2022-08-12 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | FreigrabeImpuls (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-12 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap2.mp3 | 2022-08-12 11:23 | 0 | |
![[SND]](/icons/sound2.gif) | Dhije.mp3 | 2022-08-12 11:18 | 3.3M | |
![[SND]](/icons/sound2.gif) | Thinkdick.mp3 | 2022-08-12 11:18 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY5.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY6.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY3.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY4.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY2.mp3 | 2022-08-12 11:17 | 0 | |
![[SND]](/icons/sound2.gif) | GREEY1.mp3 | 2022-08-12 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | shesgone .mp3 | 2022-08-12 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | Dj sikok bagi duo.mp3 | 2022-08-12 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | Old Love - Yuji _ Putri Dahlia.mp3 | 2022-08-12 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | dingdut1.mp3 | 2022-08-12 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | DhikaSad (1).mp3 | 2022-08-12 11:05 | 1.2M | |
![[SND]](/icons/sound2.gif) | ilham11.mp3 | 2022-08-12 11:03 | 1.9M | |
![[SND]](/icons/sound2.gif) | wtf.mp3 | 2022-08-12 11:03 | 1.6M | |
![[SND]](/icons/sound2.gif) | Myz1.mp3 | 2022-08-12 10:58 | 0 | |
![[SND]](/icons/sound2.gif) | selebew.mp3 | 2022-08-12 10:57 | 0 | |
![[SND]](/icons/sound2.gif) | M.I.B - Jak (Official MV).mp3 | 2022-08-12 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | Marshi I UÇK (Albanian War Song).mp3 | 2022-08-12 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | omda1.mp3 | 2022-08-12 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-moneyken-love-speed-up.mp3 | 2022-08-12 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | King of Doowhite - Maiyarap ft.Repaze [Official MV].mp3 | 2022-08-12 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | sova-pesni-staryh-kasset.mp3 | 2022-08-12 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | chillbuon1199.mp3 | 2022-08-12 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | VY.mp3 | 2022-08-12 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Баллада о забытом мире.mp3 | 2022-08-12 10:39 | 212K | |
![[SND]](/icons/sound2.gif) | white_NH4XfTU.mp3 | 2022-08-12 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0whlYJAI.mp3 | 2022-08-12 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0Njc72gq.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | nhacthattinh1129.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | ajimat.mp3 | 2022-08-12 10:35 | 916K | |
![[SND]](/icons/sound2.gif) | chpunk-edison-ochko.mp3 | 2022-08-12 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | not-for-sale-fossil-kanon-wakeshima-4786337666483773616_DGtX5sbw.mp3 | 2022-08-12 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | pesnya-ya-mazhu-vazelinom.mp3 | 2022-08-12 10:21 | 0 | |
![[SND]](/icons/sound2.gif) | dajte-tank-besy_(mp3IQ.net).mp3 | 2022-08-12 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | alpin.mp3 | 2022-08-12 10:16 | 0 | |
![[SND]](/icons/sound2.gif) | k111.mp3 | 2022-08-12 10:15 | 0 | |
![[SND]](/icons/sound2.gif) | They.mp3 | 2022-08-12 10:13 | 0 | |
![[SND]](/icons/sound2.gif) | Аквариум - 212-85-06 (OST ПитерFM).mp3 | 2022-08-12 10:11 | 6.5M | |
![[SND]](/icons/sound2.gif) | Dajjte_tank_-_Besy_(musmore.com).mp3 | 2022-08-12 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedkillua.mp3.mp3 | 2022-08-12 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | s99.mp3 | 2022-08-12 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | darr1.mp3 | 2022-08-12 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | rexx.mp3 | 2022-08-12 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedKillua (2).mp3 | 2022-08-12 10:06 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursedkillua.mp3 | 2022-08-12 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | dar1.mp3 | 2022-08-12 10:04 | 0 | |
![[SND]](/icons/sound2.gif) | audiomsg_641244583.mp3 | 2022-08-12 10:04 | 0 | |
![[SND]](/icons/sound2.gif) | imagelinefixyourshittyprogram.mp3 | 2022-08-12 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | DANY8081.mp3 | 2022-08-12 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | darar1.mp3 | 2022-08-12 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | The.mp3 | 2022-08-12 09:59 | 104K | |
![[SND]](/icons/sound2.gif) | Falmengkane11.mp3 | 2022-08-12 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | yahah.mp3 | 2022-08-12 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | The Yes Yes Show - Francis M & Parokya Ni Edgar.mp3 | 2022-08-12 09:52 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ KANDAS DANGDUT DJ KANDAS JEDAG JEDUG SLOW FULL BASS VIRAL FYP TIK TOK 2022.mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | GREYGODS[ConverteZilla.com].mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursed_Killua.mp3 | 2022-08-12 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | sunroof.mp3 | 2022-08-12 09:50 | 2.7M | |
![[SND]](/icons/sound2.gif) | k6.mp3 | 2022-08-12 09:49 | 1.9M | |
![[SND]](/icons/sound2.gif) | k5.mp3 | 2022-08-12 09:48 | 7.7M | |
![[SND]](/icons/sound2.gif) | zxcursed_-_killua_74293338.mp3 | 2022-08-12 09:45 | 0 | |
![[SND]](/icons/sound2.gif) | GARUDA.mp3 | 2022-08-12 09:43 | 0 | |
![[SND]](/icons/sound2.gif) | Klava_Bravo_Nazyvaj_menya_trener_remiks.mp3 | 2022-08-12 09:42 | 2.1M | |
![[SND]](/icons/sound2.gif) | k3.mp3 | 2022-08-12 09:41 | 3.1M | |
![[SND]](/icons/sound2.gif) | fridaynight.mp3 | 2022-08-12 09:38 | 3.2M | |
![[SND]](/icons/sound2.gif) | Djenak.mp3 | 2022-08-12 09:36 | 4.0M | |
![[SND]](/icons/sound2.gif) | XD5.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_Shadow_Fiend_73331416.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | shadowfiend_feat_perfect_player_-_shadowraze_71630335.mp3 | 2022-08-12 09:33 | 0 | |
![[SND]](/icons/sound2.gif) | joy100.mp3 | 2022-08-12 09:32 | 0 | |
![[SND]](/icons/sound2.gif) | XD4.mp3 | 2022-08-12 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze_-_juggernaut_Prod_by_PLVSTIC_Prod_by_PLVSTIC_73220345.mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20_-_21.mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze_babyswishh1_-_psiblades_73220334 (1).mp3 | 2022-08-12 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | XD3.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD2.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD6.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20-21.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | zxcursed_-_never_enough_74046259.mp3 | 2022-08-12 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | XD1.mp3 | 2022-08-12 09:21 | 0 | |
![[SND]](/icons/sound2.gif) | nelsen.mp3 | 2022-08-12 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim_20-20.mp3 | 2022-08-12 09:06 | 5.2M | |
![[SND]](/icons/sound2.gif) | mikedingin.mp3 | 2022-08-12 09:03 | 4.5M | |
![[SND]](/icons/sound2.gif) | BAKAR.mp3 | 2022-08-12 09:03 | 4.2M | |
![[SND]](/icons/sound2.gif) | ER.mp3 | 2022-08-12 09:02 | 3.6M | |
![[SND]](/icons/sound2.gif) | rakhim_20_20.mp3 | 2022-08-12 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | mike2.mp3 | 2022-08-12 08:57 | 0 | |
![[SND]](/icons/sound2.gif) | xvx.mp3 | 2022-08-12 08:54 | 0 | |
![[SND]](/icons/sound2.gif) | sepka.mp3 | 2022-08-12 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | shen.mp3 | 2022-08-12 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | xa.mp3 | 2022-08-12 08:44 | 3.8M | |
![[SND]](/icons/sound2.gif) | tothebone.mp3 | 2022-08-12 08:42 | 2.0M | |
![[SND]](/icons/sound2.gif) | beautyandbeat.mp3 | 2022-08-12 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | Xybca5.mp3 | 2022-08-12 08:37 | 0 | |
![[SND]](/icons/sound2.gif) | Sektor_Gaza_-_Kolkhoznyjj_pank_48646528.mp3 | 2022-08-12 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | cigar.mp3 | 2022-08-12 08:30 | 0 | |
![[SND]](/icons/sound2.gif) | Sergejj_Zavyalov_-_Ty_dlya_menya_odna_62331592.mp3 | 2022-08-12 08:30 | 0 | |
![[SND]](/icons/sound2.gif) | BOJO.mp3 | 2022-08-12 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | ANJ.mp3 | 2022-08-12 08:20 | 0 | |
![[SND]](/icons/sound2.gif) | SOUND JJ ZERSOFBOY.mp3 | 2022-08-12 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | anditox.mp3 | 2022-08-12 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | vv.mp3 | 2022-08-12 08:16 | 200K | |
![[SND]](/icons/sound2.gif) | Cardi_B_Megan_Thee_Stallion_-_WAP_70519836.mp3 | 2022-08-12 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | BOBOLE.mp3 | 2022-08-12 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | casablanca.mp3 | 2022-08-12 08:15 | 256K | |
![[SND]](/icons/sound2.gif) | luce4.mp3 | 2022-08-12 08:14 | 0 | |
![[SND]](/icons/sound2.gif) | gehoy.mp3 | 2022-08-12 08:11 | 0 | |
![[SND]](/icons/sound2.gif) | ww.mp3 | 2022-08-12 08:11 | 2.8M | |
![[SND]](/icons/sound2.gif) | ayana.mp3 | 2022-08-12 08:09 | 0 | |
![[SND]](/icons/sound2.gif) | comeonradio.mp3 | 2022-08-12 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | SnapTik_7051841172783910170.mp3 | 2022-08-12 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | Mobb Deep - Shook Ones, Pt. II (Official HD Video).mp3 | 2022-08-12 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | ComeInside3.mp3 | 2022-08-12 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | OOR3.mp3 | 2022-08-12 08:02 | 1.8M | |
![[SND]](/icons/sound2.gif) | Decade1.mp3 | 2022-08-12 07:58 | 0 | |
![[SND]](/icons/sound2.gif) | DJBABA.mp3 | 2022-08-12 07:57 | 0 | |
![[SND]](/icons/sound2.gif) | A05.mp3 | 2022-08-12 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | A04.mp3 | 2022-08-12 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | A03.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | A02.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Yang Peng - Long Night Journey.mp3 | 2022-08-12 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Just Friends - Pee Wee Gaskins Instrument (minus one karoke version, no vocal) lyric.mp3 | 2022-08-12 07:54 | 0 | |
![[SND]](/icons/sound2.gif) | OOR2.mp3 | 2022-08-12 07:53 | 0 | |
![[SND]](/icons/sound2.gif) | Aarne feat. Big Baby Tape - Ski Ski (2).mp3 | 2022-08-12 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | RdP12.mp3 | 2022-08-12 07:44 | 0 | |
![[SND]](/icons/sound2.gif) | TULUS-Monokrom-Official-Music-Video_QqJ-Vp8mvbk.mp3 | 2022-08-12 07:43 | 0 | |
![[SND]](/icons/sound2.gif) | Decade9.mp3 | 2022-08-12 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | fivem3.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | OOR1.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | Sugaldo Ganteng.mp3 | 2022-08-12 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | on.mp3 | 2022-08-12 07:32 | 2.4M | |
![[SND]](/icons/sound2.gif) | ALX.mp3 | 2022-08-12 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | Zv1.mp3 | 2022-08-12 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | bp-du2.mp3 | 2022-08-12 07:25 | 0 | |
![[SND]](/icons/sound2.gif) | bp-du.mp3 | 2022-08-12 07:22 | 0 | |
![[SND]](/icons/sound2.gif) | shadowraze.mp3 | 2022-08-12 07:22 | 4.6M | |
![[SND]](/icons/sound2.gif) | rc.mp3 | 2022-08-12 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Modern Talking — Cheri Cheri Lady.mp3 | 2022-08-12 07:17 | 0 | |
![[SND]](/icons/sound2.gif) | Мурат Тхагалегов - За тебя Калым отдам.mp3 | 2022-08-12 07:17 | 208K | |
![[SND]](/icons/sound2.gif) | Binibirocha.mp3 | 2022-08-12 07:14 | 3.2M | |
![[SND]](/icons/sound2.gif) | INSTASAMKA – MONEYKEN LOVE prod realmoneyken.mp3 | 2022-08-12 07:13 | 0 | |
![[SND]](/icons/sound2.gif) | RV.mp3 | 2022-08-12 07:10 | 0 | |
![[SND]](/icons/sound2.gif) | rv-fmr1.mp3 | 2022-08-12 07:06 | 0 | |
![[SND]](/icons/sound2.gif) | MESSII.mp3 | 2022-08-12 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | rv-fmr.mp3 | 2022-08-12 06:58 | 0 | |
![[SND]](/icons/sound2.gif) | dr-dre-deep-cover-feat-snoop-dogg.mp3 | 2022-08-12 06:55 | 9.8M | |
![[VID]](/icons/movie.gif) | Tan2.mp4 | 2022-08-12 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | Freddie Dredd - All Alone.mp3 | 2022-08-12 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | snoop-dogg-dr-dre-deep-cover-uncensored.mp3 | 2022-08-12 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | Dr. Dre - Deep Cover (feat. Snoop Dogg) (mp3store.cc).mp3 | 2022-08-12 06:53 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-moya-kiska-dlya-nego-vsegda-gotova.mp3 | 2022-08-12 06:53 | 0 | |
![[SND]](/icons/sound2.gif) | Psych - 9 Мая [Рэп-Столица]_(tiktok-pesni.com).mp3 | 2022-08-12 06:50 | 0 | |
![[VID]](/icons/movie.gif) | tan.mp4 | 2022-08-12 06:47 | 408K | |
![[SND]](/icons/sound2.gif) | aespa-lts.mp3 | 2022-08-12 06:45 | 2.9M | |
![[SND]](/icons/sound2.gif) | BORNEO.mp3 | 2022-08-12 06:43 | 8.0M | |
![[SND]](/icons/sound2.gif) | ikmal.mp3 | 2022-08-12 06:39 | 278K | |
![[SND]](/icons/sound2.gif) | hejoboys.mp3 | 2022-08-12 06:36 | 0 | |
![[SND]](/icons/sound2.gif) | N3.mp3 | 2022-08-12 06:35 | 0 | |
![[SND]](/icons/sound2.gif) | N2.mp3 | 2022-08-12 06:34 | 0 | |
![[SND]](/icons/sound2.gif) | akamsi.mp3 | 2022-08-12 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | N1.mp3 | 2022-08-12 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | あれくん Alekun「ずるいよ、、、」Zurui yo _Lyrics.mp3 | 2022-08-12 06:24 | 0 | |
![[SND]](/icons/sound2.gif) | #Lyric WEST MELANESIA.mp3 | 2022-08-12 06:23 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - GUYONWATON OFFICIAL SEBATAS TEMAN OFFICIAL LYRIC VIDEO.mp3 | 2022-08-12 06:23 | 0 | |
![[SND]](/icons/sound2.gif) | sound.mp3 | 2022-08-12 06:21 | 0 | |
![[SND]](/icons/sound2.gif) | jah-khalib-guf-na-svoyom-vajbe-mp3.mp3 | 2022-08-12 06:18 | 0 | |
![[SND]](/icons/sound2.gif) | Jah Khalib _ Guf - На Своём Vibe.mp3 | 2022-08-12 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Mario Zwinkle X Keilandboi - Heavy In The Game INSTRUMENTAL.mp3 | 2022-08-12 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Пошлая Молли - Нон стоп.mp3 | 2022-08-12 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | bagiduo.mp3 | 2022-08-12 06:07 | 4.3M | |
![[SND]](/icons/sound2.gif) | gtw.mp3 | 2022-08-12 05:58 | 0 | |
![[SND]](/icons/sound2.gif) | Dj.mp3 | 2022-08-12 05:56 | 0 | |
![[SND]](/icons/sound2.gif) | nicaplaylist.mp3 | 2022-08-12 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | mabukcinta.mp3 | 2022-08-12 05:50 | 0 | |
![[SND]](/icons/sound2.gif) | SANS.mp3 | 2022-08-12 05:50 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra7.mp3 | 2022-08-12 05:49 | 0 | |
![[SND]](/icons/sound2.gif) | SKIN.mp3 | 2022-08-12 05:48 | 0 | |
![[SND]](/icons/sound2.gif) | LL.mp3 | 2022-08-12 05:46 | 2.8M | |
![[SND]](/icons/sound2.gif) | Wolve.mp3 | 2022-08-12 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | Честный - Мама.mp3 | 2022-08-12 05:45 | 0 | |
![[SND]](/icons/sound2.gif) | Glooco2.mp3 | 2022-08-12 05:42 | 1.6M | |
![[SND]](/icons/sound2.gif) | Glooco1.mp3 | 2022-08-12 05:41 | 467K | |
![[SND]](/icons/sound2.gif) | DhikaSad.mp3 | 2022-08-12 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | DEYO.mp3 | 2022-08-12 05:38 | 184K | |
![[SND]](/icons/sound2.gif) | kkk.mp3 | 2022-08-12 05:37 | 2.2M | |
![[SND]](/icons/sound2.gif) | plume.mp3 | 2022-08-12 05:36 | 0 | |
![[SND]](/icons/sound2.gif) | XNCX.mp3 | 2022-08-12 05:33 | 52K | |
![[SND]](/icons/sound2.gif) | mp13.mp3 | 2022-08-12 05:32 | 4.2M | |
![[SND]](/icons/sound2.gif) | plenka_-_Call_Me_(Slowed).mp3 | 2022-08-12 05:28 | 6.2M | |
![[SND]](/icons/sound2.gif) | prodby668_-_prolly_my_spookiest_beat_sped_up_73964471.mp3 | 2022-08-12 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | Lemon_Demon_-_Touch-Tone_Telephone_69649037.mp3 | 2022-08-12 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | WESTLBRTY'S - SAN-FIERRO.mp3 | 2022-08-12 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | sss.mp3 | 2022-08-12 05:18 | 3.0M | |
![[SND]](/icons/sound2.gif) | friendcity1.mp3 | 2022-08-12 05:18 | 0 | |
![[SND]](/icons/sound2.gif) | pasoori.mp3 | 2022-08-12 05:15 | 3.6M | |
![[SND]](/icons/sound2.gif) | friends1.mp3 | 2022-08-12 05:15 | 0 | |
![[SND]](/icons/sound2.gif) | friends2.mp3 | 2022-08-12 05:14 | 0 | |
![[SND]](/icons/sound2.gif) | Norin.mp3 | 2022-08-12 05:14 | 880K | |
![[SND]](/icons/sound2.gif) | friend1.mp3 | 2022-08-12 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | frend1.mp3 | 2022-08-12 05:09 | 0 | |
![[SND]](/icons/sound2.gif) | da.mp3 | 2022-08-12 05:07 | 3.1M | |
![[SND]](/icons/sound2.gif) | aku selalu bahagia.mp3 | 2022-08-12 05:06 | 0 | |
![[SND]](/icons/sound2.gif) | หูไม่ตรงกับตา.mp3 | 2022-08-12 05:06 | 0 | |
![[SND]](/icons/sound2.gif) | WE_NEVER_DIE_-_BROKER_NEIRP_ANTHEM_OFFICIAL_AUDIO_(Prod.By_Rifky_Arizaldy)(128k).mp3 | 2022-08-12 05:04 | 3.0M | |
![[SND]](/icons/sound2.gif) | ck.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | friend-1.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | 4WHEEL_-_KERAUNOS_KILLER_73336472.mp3 | 2022-08-12 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | Psyco M - Plume-Psyco-M.mp3 | 2022-08-12 04:44 | 0 | |
![[SND]](/icons/sound2.gif) | Party.mp3 | 2022-08-12 04:35 | 0 | |
![[SND]](/icons/sound2.gif) | Journey_-_Separate_Ways_Worlds_Apa_(getmp3.pro).mp3 | 2022-08-12 04:31 | 0 | |
![[SND]](/icons/sound2.gif) | Endank.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | Bungul3.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | Bungul4.mp3 | 2022-08-12 04:27 | 0 | |
![[SND]](/icons/sound2.gif) | who.mp3 | 2022-08-12 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | bck.mp3 | 2022-08-12 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | CL.mp3 | 2022-08-12 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | milisikecoa.mp3 | 2022-08-12 04:12 | 0 | |
![[SND]](/icons/sound2.gif) | PERFECTCHRISTMAS.mp3 | 2022-08-12 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | tklove.mp3 | 2022-08-12 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | 徐佳莹&阿爆&Brandy-切歌 feat. ABAO阿爆&Brandy.mp3 | 2022-08-12 03:32 | 0 | |
![[SND]](/icons/sound2.gif) | Azari_-_Nightmare_(musmore.com).mp3 | 2022-08-12 03:28 | 0 | |
![[SND]](/icons/sound2.gif) | hot60.mp3 | 2022-08-12 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ TELOLET X RINDU SEMALAM SLOW Viral Di Fyp TikTok.mp3 | 2022-08-12 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | rap100.mp3 | 2022-08-12 03:14 | 0 | |
![[SND]](/icons/sound2.gif) | p2.mp3 | 2022-08-12 03:10 | 536K | |
![[SND]](/icons/sound2.gif) | bangbang.mp3 | 2022-08-12 03:06 | 0 | |
![[SND]](/icons/sound2.gif) | (26,29,35,40hz)Need for Speed - Get Low(Screwed by Gorilla_Bass).mp3 | 2022-08-12 03:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dissah Dzu - Uatnek 21.mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | BODIEV - Между девятин.mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | 77-й'. - .mp3 | 2022-08-12 02:58 | 0 | |
![[SND]](/icons/sound2.gif) | 1-❤ - качает`.mp3 | 2022-08-12 02:58 | 2.0M | |
![[SND]](/icons/sound2.gif) | p1.mp3 | 2022-08-12 02:47 | 214K | |
![[SND]](/icons/sound2.gif) | Ben3.mp3 | 2022-08-12 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | WestBarrio.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | Takbo.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | BCFL.mp3 | 2022-08-12 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | Pagmamahal.mp3 | 2022-08-12 02:28 | 0 | |
![[SND]](/icons/sound2.gif) | OneOfTheseDays.mp3 | 2022-08-12 02:28 | 0 | |
![[SND]](/icons/sound2.gif) | bang3.mp3 | 2022-08-12 02:24 | 0 | |
![[SND]](/icons/sound2.gif) | andika1.mp3 | 2022-08-12 02:09 | 0 | |
![[SND]](/icons/sound2.gif) | AjimatMG.mp3 | 2022-08-12 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | hatepok1.mp3 | 2022-08-12 02:08 | 0 | |
![[SND]](/icons/sound2.gif) | SAY.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | How.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | NOTHING.mp3 | 2022-08-12 02:07 | 3.8M | |
![[SND]](/icons/sound2.gif) | Never.mp3 | 2022-08-12 02:07 | 3.2M | |
![[SND]](/icons/sound2.gif) | FOREVER.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | Thewill.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | EXCHANGE.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | KLM.mp3 | 2022-08-12 02:07 | 0 | |
![[SND]](/icons/sound2.gif) | andika1.m4a | 2022-08-12 02:02 | 0 | |
![[SND]](/icons/sound2.gif) | Jewish Princess.mp3 | 2022-08-12 02:00 | 0 | |
![[SND]](/icons/sound2.gif) | xwan39.mp3 | 2022-08-12 01:59 | 0 | |
![[SND]](/icons/sound2.gif) | xwan40.mp3 | 2022-08-12 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | xwan41.mp3 | 2022-08-12 01:58 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Round Change - Shadows of Evil - Soundtrack-OGYa9IrOf9s-160k-1660269164390.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np6.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np5.mp3 | 2022-08-12 01:54 | 0 | |
![[SND]](/icons/sound2.gif) | np4.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np3.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Pagsamo.mp3 | 2022-08-12 01:53 | 4.4M | |
![[SND]](/icons/sound2.gif) | Say.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Mapa.mp3 | 2022-08-12 01:53 | 2.2M | |
![[SND]](/icons/sound2.gif) | NOBITA.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | the will.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Binibini.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np2.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Exchange.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | np1.mp3 | 2022-08-12 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | tarik1.mp3 | 2022-08-12 01:52 | 3.3M | |
![[SND]](/icons/sound2.gif) | M.T.G - (Only Fans feat. No1-NOAH .mp3 | 2022-08-12 01:51 | 0 | |
![[SND]](/icons/sound2.gif) | Forevermore.mp3 | 2022-08-12 01:47 | 812K | |
![[SND]](/icons/sound2.gif) | TheFinal.mp3 | 2022-08-12 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Vendredi13Août2021.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw1.mp3 | 2022-08-12 01:26 | 80K | |
![[SND]](/icons/sound2.gif) | Dw3.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw2.mp3 | 2022-08-12 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | Dw5.mp3 | 2022-08-12 01:26 | 1.6M | |
![[SND]](/icons/sound2.gif) | lagu1.mp3 | 2022-08-12 01:24 | 1.1M | |
![[SND]](/icons/sound2.gif) | Afgan - Jodoh Pasti Bertemu Official Video Clip.mp3 | 2022-08-12 01:23 | 0 | |
![[SND]](/icons/sound2.gif) | On The Floor - Jennifer Lopez.mp3 | 2022-08-12 01:22 | 5.7M | |
![[SND]](/icons/sound2.gif) | Kesariya (From Brahmastra) - Pritam.mp3 | 2022-08-12 01:22 | 4.1M | |
![[SND]](/icons/sound2.gif) | Hookah Bar (LoFi) - Shubham Rangra.mp3 | 2022-08-12 01:22 | 4.4M | |
![[SND]](/icons/sound2.gif) | Sodakku_From_Thaanaa_Serndha_Koottam_Anirudh_Ravichander.mp3 | 2022-08-12 01:22 | 3.7M | |
![[SND]](/icons/sound2.gif) | Azhalinte_Azhangalil_From_Ayalum_Njanum_Thammil_Male_Vocals_Nikhil.mp3 | 2022-08-12 01:22 | 5.2M | |
![[SND]](/icons/sound2.gif) | Kudukku - Vineeth Sreenivasan.mp3 | 2022-08-12 01:21 | 2.4M | |
![[SND]](/icons/sound2.gif) | mn.mp3 | 2022-08-12 01:21 | 2.4M | |
![[SND]](/icons/sound2.gif) | Project - 8:11:22, 5.59 PM.mp3 | 2022-08-12 01:20 | 0 | |
![[SND]](/icons/sound2.gif) | v4.mp3 | 2022-08-12 01:19 | 3.4M | |
![[SND]](/icons/sound2.gif) | Vicks1.mp3 | 2022-08-12 01:18 | 1.3M | |
![[SND]](/icons/sound2.gif) | v5.mp3 | 2022-08-12 01:15 | 388K | |
![[SND]](/icons/sound2.gif) | Jejennie.mp3 | 2022-08-12 01:14 | 0 | |
![[SND]](/icons/sound2.gif) | mygang.mp3 | 2022-08-12 01:11 | 0 | |
![[SND]](/icons/sound2.gif) | 1_4943094942051336640.mp3 | 2022-08-12 01:09 | 0 | |
![[SND]](/icons/sound2.gif) | Took Him Too - John Sebby Elliott Sheridan.mp3 | 2022-08-12 01:08 | 0 | |
![[SND]](/icons/sound2.gif) | matila.mp3 | 2022-08-12 01:06 | 0 | |
![[SND]](/icons/sound2.gif) | Razz1.mp3 | 2022-08-12 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | phupu.mp3 | 2022-08-12 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | 7077114216255064859.mp3 | 2022-08-12 00:59 | 0 | |
![[SND]](/icons/sound2.gif) | N1NT3ND0_-_CHP_47965410.mp3 | 2022-08-12 00:55 | 0 | |
![[SND]](/icons/sound2.gif) | puresouls7.22.19.mp3 | 2022-08-12 00:50 | 0 | |
![[SND]](/icons/sound2.gif) | LILDRUGHILL_MARCO_9_Jet.mp3 | 2022-08-12 00:42 | 0 | |
![[SND]](/icons/sound2.gif) | rastaman-ne-nuzhna-mne-korona-princessa-i-gory.mp3 | 2022-08-12 00:36 | 0 | |
![[SND]](/icons/sound2.gif) | N1NT3ND0 - ЧП.mp3 | 2022-08-12 00:36 | 0 | |
![[SND]](/icons/sound2.gif) | LILDRUGHILL_ROCKET_Terminal.mp3 | 2022-08-12 00:35 | 0 | |
![[SND]](/icons/sound2.gif) | Jennie1945.mp3 | 2022-08-12 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | Rin Ljubav for life.mp3 | 2022-08-12 00:27 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen2.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen3.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen5.mp3 | 2022-08-12 00:17 | 0 | |
![[SND]](/icons/sound2.gif) | pu.mp3 | 2022-08-12 00:16 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen4.mp3 | 2022-08-12 00:15 | 0 | |
![[SND]](/icons/sound2.gif) | Brayen1.mp3 | 2022-08-12 00:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta1.mp3 | 2022-08-12 00:11 | 0 | |
![[SND]](/icons/sound2.gif) | Ytta40.mp3 | 2022-08-12 00:08 | 0 | |
![[SND]](/icons/sound2.gif) | Phu.mp3 | 2022-08-12 00:08 | 2.5M | |
![[SND]](/icons/sound2.gif) | Gnjr.mp3 | 2022-08-12 00:06 | 2.4M | |
![[SND]](/icons/sound2.gif) | Sbbg.mp3 | 2022-08-12 00:05 | 0 | |
![[SND]](/icons/sound2.gif) | Gnjrrmx.mp3 | 2022-08-12 00:05 | 0 | |
![[SND]](/icons/sound2.gif) | Abubudu.mp3 | 2022-08-11 23:54 | 0 | |
![[SND]](/icons/sound2.gif) | DIBANDINGKE.mp3 | 2022-08-11 23:53 | 3.0M | |
![[SND]](/icons/sound2.gif) | JENNIENATAEL90.mp3 | 2022-08-11 23:47 | 4.5M | |
![[SND]](/icons/sound2.gif) | mood.mp3 | 2022-08-11 23:46 | 2.1M | |
![[SND]](/icons/sound2.gif) | ChippedAx.mp3 | 2022-08-11 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Chipped Ax - Lion Numchok and Joke So Cool (Official MV)(MP3_320K).mp3 | 2022-08-11 23:41 | 0 | |
![[SND]](/icons/sound2.gif) | Sabilulungan Trap.mp3 | 2022-08-11 23:32 | 0 | |
![[SND]](/icons/sound2.gif) | Genjer Genjer (1).mp3 | 2022-08-11 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | genjer genjer remix .mp3 | 2022-08-11 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | MAZ_KORZH_-_negry_vse_pidorasy_(iPleer.com).mp3 | 2022-08-11 23:21 | 0 | |
![[SND]](/icons/sound2.gif) | DVRST_6YNTHMANE_ANTICXLTXRE_-_Will_Be_Soon_74627715.mp3 | 2022-08-11 23:12 | 0 | |
![[SND]](/icons/sound2.gif) | Maz_Korzh_Ya_pomnyu_mazellovvv.mp3 | 2022-08-11 23:04 | 7.1M | |
![[SND]](/icons/sound2.gif) | Apple TV Imp.mp3 | 2022-08-11 23:00 | 0 | |
![[SND]](/icons/sound2.gif) | v19.mp3 | 2022-08-11 22:58 | 0 | |
![[SND]](/icons/sound2.gif) | v20.mp3 | 2022-08-11 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | v18.mp3 | 2022-08-11 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | v17.mp3 | 2022-08-11 22:56 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.io - Tshego Morore - Project Geese (2024) (128 kbps)(1).mp3 | 2022-08-11 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | Industry Baby sped up is actually fire.mp3 | 2022-08-11 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | c3.mp3 | 2022-08-11 22:45 | 3.6M | |
![[SND]](/icons/sound2.gif) | c2.mp3 | 2022-08-11 22:45 | 4.8M | |
![[SND]](/icons/sound2.gif) | index.mp3 | 2022-08-11 22:44 | 98K | |
![[SND]](/icons/sound2.gif) | v15.mp3 | 2022-08-11 22:42 | 0 | |
![[SND]](/icons/sound2.gif) | v14.mp3 | 2022-08-11 22:30 | 0 | |
![[SND]](/icons/sound2.gif) | v13.mp3 | 2022-08-11 22:30 | 0 | |
![[SND]](/icons/sound2.gif) | v12.mp3 | 2022-08-11 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | v11.mp3 | 2022-08-11 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | v10.mp3 | 2022-08-11 22:15 | 0 | |
![[SND]](/icons/sound2.gif) | Bhjt.mp3 | 2022-08-11 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | v7.mp3 | 2022-08-11 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | v9.mp3 | 2022-08-11 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | v8.mp3 | 2022-08-11 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | instasamka-lipsi-ha-file.mp3 | 2022-08-11 22:08 | 4.8M | |
![[SND]](/icons/sound2.gif) | Keskin - Raad Yok.mp3 | 2022-08-11 22:05 | 0 | |
![[SND]](/icons/sound2.gif) | Mis.m4a | 2022-08-11 21:57 | 0 | |
![[SND]](/icons/sound2.gif) | PLAZA Installer Music - 2015 - November [bThTHiM8lkM].mp3 | 2022-08-11 21:54 | 0 | |
![[SND]](/icons/sound2.gif) | Viral Tiktok..! Dj Remix SIKOK BAGI DUO - Meli __ OT Zarly Dj Dody (320 kbps).mp3 | 2022-08-11 21:50 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze - Showdown.mp3 | 2022-08-11 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | v2.mp3 | 2022-08-11 21:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | v1.mp3 | 2022-08-11 21:45 | 2.3M | |
![[SND]](/icons/sound2.gif) | hfDr3ig2Vd8F.128.mp3 | 2022-08-11 21:37 | 0 | |
![[SND]](/icons/sound2.gif) | Acoustic guitar sound effect free download.mp3 | 2022-08-11 21:33 | 0 | |
![[VID]](/icons/movie.gif) | Smack My Bitch Up (2).mp4 | 2022-08-11 21:11 | 0 | |
![[VID]](/icons/movie.gif) | creweskan.mp4 | 2022-08-11 21:09 | 0 | |
![[SND]](/icons/sound2.gif) | Суета.mp3 | 2022-08-11 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | turi ip ip slowed reverb------ (remake)(MP3_128K).mp3 | 2022-08-11 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | Mantra Hujan - Kobo Kanaeru __ Acoustic Version (Lirik _ Lyrics _ TikTok Song)(MP3_160K).mp3 | 2022-08-11 21:06 | 0 | |
![[SND]](/icons/sound2.gif) | AMONG US REMIX (VERSI MAMANK GAROX)(MP3_320K).mp3 | 2022-08-11 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | darman.mp3 | 2022-08-11 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | rom1.mp3 | 2022-08-11 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | Escadas - Roll Up.mp3 | 2022-08-11 20:48 | 0 | |
![[SND]](/icons/sound2.gif) | sadalex1.mp3 | 2022-08-11 20:43 | 0 | |
![[SND]](/icons/sound2.gif) | sgK6p9bqccbnQ1100OySZqOrvNPlW10H.mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | TankTrouble (1).mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | TankTrouble.mp3 | 2022-08-11 20:40 | 0 | |
![[SND]](/icons/sound2.gif) | Depeche Mode - Never Let Me Down Again.mp3 | 2022-08-11 20:39 | 6.9M | |
![[SND]](/icons/sound2.gif) | Secret.mp3 | 2022-08-11 20:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Blingos ft EL KATIBA.mp3 | 2022-08-11 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | 21-Shields-V2.0.mp3 | 2022-08-11 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Blingos ft EL KATIBA عكس السرب Clip Officiel.mp3 | 2022-08-11 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | BO9AL.mp3 | 2022-08-11 20:31 | 0 | |
![[SND]](/icons/sound2.gif) | 2022-08-11 16-17-23_Trim.mp3 | 2022-08-11 20:30 | 0 | |
![[SND]](/icons/sound2.gif) | x.mp3 | 2022-08-11 20:30 | 93K | |
![[SND]](/icons/sound2.gif) | abdo.mp3 | 2022-08-11 20:22 | 308K | |
![[SND]](/icons/sound2.gif) | moro.mp3 | 2022-08-11 20:06 | 0 | |
![[SND]](/icons/sound2.gif) | DISCO.mp3 | 2022-08-11 19:59 | 0 | |
![[SND]](/icons/sound2.gif) | Kamazz - Как ты там.mp3 | 2022-08-11 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | FACE_-_Biznes_72861005.mp3 | 2022-08-11 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Gay.mp3 | 2022-08-11 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | Rollo Tomassi - L'homme rationnel .mp3 | 2022-08-11 19:48 | 0 | |
![[VID]](/icons/movie.gif) | Rollo Tomassi - L'homme rationnel .mp4 | 2022-08-11 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | JE.mp3 | 2022-08-11 19:47 | 0 | |
![[SND]](/icons/sound2.gif) | Suwy.mp3 | 2022-08-11 19:44 | 0 | |
![[SND]](/icons/sound2.gif) | AsianF.mp3 | 2022-08-11 19:43 | 0 | |
![[SND]](/icons/sound2.gif) | grey1.mp3 | 2022-08-11 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | CH.mp3 | 2022-08-11 19:40 | 112K | |
![[SND]](/icons/sound2.gif) | badang.mp3 | 2022-08-11 19:40 | 0 | |
![[VID]](/icons/movie.gif) | lv_0_20220804225837.mp4 | 2022-08-11 19:39 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi & Andy Panda - Minor.mp3 | 2022-08-11 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | EdwardBil_Psikhopt.mp3 | 2022-08-11 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | LD.mp3 | 2022-08-11 19:32 | 0 | |
![[SND]](/icons/sound2.gif) | ФОНК - phonk (mp3-2020.com).mp3 | 2022-08-11 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | cartoon-jump-6462.mp3 | 2022-08-11 19:31 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - ใจร้าย - ILLSLICK _ Cover By.Seen ft.Miguel (ฺBadguy) (128 kbps).mp3 | 2022-08-11 19:28 | 424K | |
![[SND]](/icons/sound2.gif) | Jonyy2.mp3 | 2022-08-11 19:18 | 0 | |
![[SND]](/icons/sound2.gif) | isolate.exe - crystals __ slowed + reverb.mp3 | 2022-08-11 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | yatz2.mp3 | 2022-08-11 19:03 | 3.6M | |
![[SND]](/icons/sound2.gif) | s6.mp3 | 2022-08-11 19:01 | 2.5M | |
![[SND]](/icons/sound2.gif) | mike1.mp3 | 2022-08-11 19:00 | 2.9M | |
![[SND]](/icons/sound2.gif) | sample.mp3 | 2022-08-11 18:59 | 0 | |
![[SND]](/icons/sound2.gif) | Middle.mp3 | 2022-08-11 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | CONSTANT.mp3 | 2022-08-11 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | Dahan.mp3 | 2022-08-11 18:56 | 3.3M | |
![[SND]](/icons/sound2.gif) | The Kiffness X Big Billy (Live Looping Talking Cat Remix).mp3 | 2022-08-11 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | SnapSave.io - เหลือแค่ส้วมที่ใช้ร่วมกัน (128 kbps).mp3 | 2022-08-11 18:53 | 0 | |
![[SND]](/icons/sound2.gif) | moan.mp3 | 2022-08-11 18:53 | 3.1M | |
![[SND]](/icons/sound2.gif) | Big Poppa Extreme Bass Boosted.mp3 | 2022-08-11 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | rakhim-sinij-lamborghini-mp3.mp3 | 2022-08-11 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | เหลือแค่ส้วมที่ใช้ร่วมกัน.mp3 | 2022-08-11 18:45 | 0 | |
![[SND]](/icons/sound2.gif) | Keizaro6.mp3 | 2022-08-11 18:40 | 4.0M | |
![[SND]](/icons/sound2.gif) | yatz3.mp3 | 2022-08-11 18:39 | 3.2M | |
![[SND]](/icons/sound2.gif) | coffe.mp3 | 2022-08-11 18:29 | 0 | |
![[SND]](/icons/sound2.gif) | 10 - Skinheads S.H..mp3 | 2022-08-11 18:20 | 172K | |
![[SND]](/icons/sound2.gif) | dgdsgdf.mp3 | 2022-08-11 18:14 | 0 | |
![[SND]](/icons/sound2.gif) | Учения безмолвного ума. (320 kbps).mp3 | 2022-08-11 18:10 | 0 | |
![[SND]](/icons/sound2.gif) | Last_Stop.mp3 | 2022-08-11 18:09 | 0 | |
![[SND]](/icons/sound2.gif) | My-Everything_HxWSDUC-KTU.mp3 | 2022-08-11 18:05 | 0 | |
![[SND]](/icons/sound2.gif) | jony.mp3 | 2022-08-11 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | Dhyo_-_Haw__Jarak_Dan_Kita___lagu_terbaru.mp3 | 2022-08-11 18:01 | 0 | |
![[SND]](/icons/sound2.gif) | ikeh1.mp3 | 2022-08-11 18:00 | 0 | |
![[SND]](/icons/sound2.gif) | senyum.mp3 | 2022-08-11 18:00 | 3.1M | |
![[SND]](/icons/sound2.gif) | Campfire Crackling warm cozy beats.mp3 | 2022-08-11 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | jony1.mp3 | 2022-08-11 17:59 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - EVAN LOSS FULL SENYUM SAYANG.mp3 | 2022-08-11 17:58 | 0 | |
![[SND]](/icons/sound2.gif) | thrill_pill_polnoch.mp3 | 2022-08-11 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | keren.mp3 | 2022-08-11 17:48 | 2.6M | |
![[VID]](/icons/movie.gif) | 4eb407f96ba5febdfecc87d5f4cc4125.mp4 | 2022-08-11 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ajs_Nigrutin_Kilo_Granja_Lesim.mp3 | 2022-08-11 17:47 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Reggae Come On Come On Turn The Radio X Sampe Bawah Fyp TikTok• Jaranan Dor • Alfin Revolution.mp3 | 2022-08-11 17:47 | 0 | |
![[SND]](/icons/sound2.gif) | DJ AMERICAN DREAMS X MELODY MENGKANE VIRAL TIKTOK.mp3 | 2022-08-11 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | 19wmnsgsuakakan.mp3 | 2022-08-11 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | Farruko - Pepas.mp3 | 2022-08-11 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | farruko-pepas.mp3 | 2022-08-11 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | [mileon] - L устал.mp3 | 2022-08-11 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | Skriptonit_-_Mister_718_51836708.mp3 | 2022-08-11 17:34 | 0 | |
![[SND]](/icons/sound2.gif) | dj3.mp3 | 2022-08-11 17:32 | 3.4M | |
![[SND]](/icons/sound2.gif) | [EldarwaR] - II - Die Lösung.mp3 | 2022-08-11 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | escltplayer8181818.mp3 | 2022-08-11 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | GTA.mp3 | 2022-08-11 17:17 | 2.5M | |
![[SND]](/icons/sound2.gif) | theyn.mp3 | 2022-08-11 17:16 | 0 | |
![[VID]](/icons/movie.gif) | SnapInsta_280653172_1075198643075739_7338141745345842817_n.mp4 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Chad sound affect-gLeydZjRwtE-48k-1660238121260.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | payt1.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | payt.mp3 | 2022-08-11 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | escltplayer.mp3 | 2022-08-11 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | singto.mp3 | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback.m4a | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | ardy03.mp3 | 2022-08-11 17:09 | 0 | |
![[SND]](/icons/sound2.gif) | ardy02.mp3 | 2022-08-11 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | 144.mp3 | 2022-08-11 17:08 | 2.4M | |
![[SND]](/icons/sound2.gif) | ardy01.mp3 | 2022-08-11 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | 199.mp3 | 2022-08-11 17:06 | 0 | |
![[VID]](/icons/movie.gif) | Y2Mate.is - Batman Beatbox-ApMzw-tyHmg-720p-1660236001700 (1).mp4 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | jian25.mp3 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | jian8.mp3 | 2022-08-11 17:01 | 0 | |
![[SND]](/icons/sound2.gif) | forum_-_belaya-noch.mp3 | 2022-08-11 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | tumsath.mp3 | 2022-08-11 16:51 | 0 | |
![[SND]](/icons/sound2.gif) | J_Balvin_Skrillex_-_In_Da_Getto_73025728.mp3 | 2022-08-11 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | Randa2.mp3 | 2022-08-11 16:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zack0.mp3 | 2022-08-11 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax2.mp3 | 2022-08-11 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax122.mp3 | 2022-08-11 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Wangy1.mp3 | 2022-08-11 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Randa4.mp3 | 2022-08-11 16:39 | 0 | |
![[SND]](/icons/sound2.gif) | DhemDJ11.mp3 | 2022-08-11 16:37 | 0 | |
![[SND]](/icons/sound2.gif) | Нагыз Казактын - Шешен амы (radio.lol).mp3 | 2022-08-11 16:35 | 0 | |
![[SND]](/icons/sound2.gif) | chippedax.mp3 | 2022-08-11 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Junko Yagami - Bay City (Extended Disco Mix) (www.hotplayer.ru).mp3 | 2022-08-11 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | こんにちは、サルカズ傭兵のハナです.m4a | 2022-08-11 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | ik100.mp3 | 2022-08-11 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | Big_Baby_Tape_Molodoj_Platon_VLYuBILAS.mp3 | 2022-08-11 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | ardyFNF.mp3 | 2022-08-11 16:19 | 0 | |
![[SND]](/icons/sound2.gif) | kayganda.mp3 | 2022-08-11 16:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ghost_Mary_On_A_Cross.mp3 | 2022-08-11 16:10 | 0 | |
![[SND]](/icons/sound2.gif) | kamalayan.mp3 | 2022-08-11 16:10 | 2.9M | |
![[SND]](/icons/sound2.gif) | Jaydee123.mp3 | 2022-08-11 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | matanda.mp3 | 2022-08-11 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | lukku.mp3 | 2022-08-11 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | Njan Jackson Allada DJ Remix _ DJ Strawz _ Soubin(MP3_70K).mp3 | 2022-08-11 16:07 | 716K | |
![[SND]](/icons/sound2.gif) | st7.mp3 | 2022-08-11 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | FNF.mp3 | 2022-08-11 16:01 | 0 | |
![[SND]](/icons/sound2.gif) | thrill-pill-polnoch.mp3 | 2022-08-11 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | Jroa.mp3 | 2022-08-11 15:55 | 0 | |
![[SND]](/icons/sound2.gif) | KAMENRIDER.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | JennieNatael1.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | fancyadamvanhammerslicemenice.mp3 | 2022-08-11 15:53 | 0 | |
![[SND]](/icons/sound2.gif) | chdn.mp3 | 2022-08-11 15:51 | 0 | |
![[SND]](/icons/sound2.gif) | JEN.mp3 | 2022-08-11 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | AMMU.mp3 | 2022-08-11 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | Herocashcash.mp3 | 2022-08-11 15:34 | 376K | |
![[SND]](/icons/sound2.gif) | dhije2.mp3 | 2022-08-11 15:34 | 3.4M | |
![[SND]](/icons/sound2.gif) | bgm1vmrp.mp3 | 2022-08-11 15:30 | 348K | |
![[SND]](/icons/sound2.gif) | Sample-audio-demo.mp3 | 2022-08-11 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | JIMIN (BTS) & HA SUNG WOON - With You (OST Our Blues Part.4) [320 kbps].mp3 | 2022-08-11 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | 505.mp3 | 2022-08-11 15:28 | 576K | |
![[SND]](/icons/sound2.gif) | 9999.mp3 | 2022-08-11 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | Reyy2.mp3 | 2022-08-11 15:20 | 0 | |
![[SND]](/icons/sound2.gif) | 55.mp3 | 2022-08-11 15:17 | 2.4M | |
![[SND]](/icons/sound2.gif) | dj2.mp3 | 2022-08-11 15:16 | 5.5M | |
![[SND]](/icons/sound2.gif) | Lyusya_CHebotina_-_SOLNCE_MONAKO_73236442.mp3 | 2022-08-11 15:16 | 0 | |
![[SND]](/icons/sound2.gif) | JAY DVRDEN-akatsuki.exe-kissvk.com.mp3 | 2022-08-11 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | EDSON NUÑEZ DANIEL LÜDTKE GRACIA CLIPE OFICIAL.mp3 | 2022-08-11 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | aarne-feat.-anikv-bushido-zho-tesno.mp3 | 2022-08-11 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | Gazan_-_ABU_BANDIT_71958609.mp3 | 2022-08-11 15:11 | 0 | |
![[SND]](/icons/sound2.gif) | AFSAL3.mp3 | 2022-08-11 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | AFSAL2.mp3 | 2022-08-11 15:09 | 0 | |
![[SND]](/icons/sound2.gif) | DJAKUMAU.mp3 | 2022-08-11 15:05 | 0 | |
![[SND]](/icons/sound2.gif) | Lil Uzi Vert - XO Tour Llif3 (Official Music Video) (mp3cut.net) (1).mp3 | 2022-08-11 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | ข.mp3 | 2022-08-11 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | play_back.mp3 | 2022-08-11 14:45 | 0 | |
![[SND]](/icons/sound2.gif) | asekGG.mp3 | 2022-08-11 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | bale1.mp3 | 2022-08-11 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Cau 3.1 - Minna - Nghe.mp3 | 2022-08-11 14:33 | 0 | |
![[SND]](/icons/sound2.gif) | Zer.mp3 | 2022-08-11 14:30 | 0 | |
![[SND]](/icons/sound2.gif) | beat.mp3 | 2022-08-11 14:29 | 5.4M | |
![[SND]](/icons/sound2.gif) | cj7.mp3 | 2022-08-11 14:25 | 0 | |
![[SND]](/icons/sound2.gif) | BBBB.mp3 | 2022-08-11 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | likin.mp3 | 2022-08-11 14:22 | 0 | |
![[SND]](/icons/sound2.gif) | gedh.mp3 | 2022-08-11 14:19 | 0 | |
![[SND]](/icons/sound2.gif) | Aarne_BUSHIDO_ZHO_ANIKV_-_Tesno_74640918.mp3 | 2022-08-11 14:12 | 0 | |
![[SND]](/icons/sound2.gif) | aljona_shvec_-_Barabanshhica_73921923.mp3 | 2022-08-11 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | DJRANX.mp3 | 2022-08-11 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | birthday1.mp3 | 2022-08-11 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | YOYO.mp3 | 2022-08-11 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | indonesia.mp3 | 2022-08-11 13:50 | 0 | |
![[SND]](/icons/sound2.gif) | lagu.mp3 | 2022-08-11 13:49 | 332K | |
![[SND]](/icons/sound2.gif) | y2mate.com - LAGU INDONESIA RAYA TEXT DAN VOCAL ORIGINAL OFFICIAL.mp3 | 2022-08-11 13:48 | 0 | |
![[SND]](/icons/sound2.gif) | sparks.mp3 | 2022-08-11 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | tekit.mp3 | 2022-08-11 13:42 | 2.5M | |
![[SND]](/icons/sound2.gif) | myworld.mp3 | 2022-08-11 13:40 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap1.mp3 | 2022-08-11 13:37 | 2.5M | |
![[SND]](/icons/sound2.gif) | Hans zimmer - Interstellar No Time for Caution.mp3 | 2022-08-11 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | crycgs.mp3 | 2022-08-11 13:34 | 0 | |
![[SND]](/icons/sound2.gif) | MAMA.mp3 | 2022-08-11 13:34 | 2.1M | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX VIRAL TIKTOK TERBARU 2022 JEDAG JEDUG FULL BASS DJ CAMPURAN.mp3 | 2022-08-11 13:34 | 0 | |
![[SND]](/icons/sound2.gif) | Berkelana1.mp3 | 2022-08-11 13:32 | 0 | |
![[SND]](/icons/sound2.gif) | bublegum.mp3 | 2022-08-11 13:31 | 0 | |
![[SND]](/icons/sound2.gif) | sb.mp3 | 2022-08-11 13:30 | 0 | |
![[SND]](/icons/sound2.gif) | james.mp3 | 2022-08-11 13:29 | 508K | |
![[SND]](/icons/sound2.gif) | pendhoza_pendhoza-ninggal-janji-new-version(2).mp3 | 2022-08-11 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Kopikap4.mp3 | 2022-08-11 13:27 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk.mp3 | 2022-08-11 13:25 | 1.3M | |
![[SND]](/icons/sound2.gif) | Putri Kristya Gubuk Asmoro DC Musik.mp3 | 2022-08-11 13:25 | 0 | |
![[SND]](/icons/sound2.gif) | Bojo2.mp3 | 2022-08-11 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | meoww1.mp3 | 2022-08-11 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | Https.github.mp3 | 2022-08-11 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik(6).mp3 | 2022-08-11 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | download.mp3 | 2022-08-11 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | Bojo1.mp3 | 2022-08-11 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | geng04.mp3 | 2022-08-11 13:18 | 756K | |
![[SND]](/icons/sound2.gif) | Everyday Normal Guy 2.mp3 | 2022-08-11 13:18 | 157K | |
![[VID]](/icons/movie.gif) | Eminem - Venom.mp4 | 2022-08-11 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | Tiara1.mp3 | 2022-08-11 13:15 | 0 | |
![[SND]](/icons/sound2.gif) | Farel2.mp3 | 2022-08-11 13:15 | 0 | |
![[SND]](/icons/sound2.gif) | Satru2.mp3 | 2022-08-11 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | Shade.mp3 | 2022-08-11 13:09 | 2.8M | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]Gugur Bunga Versi Asli.xnkeuf-Jtqc.mp3 | 2022-08-11 13:08 | 520K | |
![[SND]](/icons/sound2.gif) | alok.mp3 | 2022-08-11 13:08 | 1.5M | |
![[SND]](/icons/sound2.gif) | Davin4.mp3 | 2022-08-11 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | j-hope-bts-more-mp3.mp3 | 2022-08-11 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | Davin5.mp3 | 2022-08-11 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | Cheriimoya_Living_life_in_the_night_remix.mp3 | 2022-08-11 13:02 | 0 | |
![[SND]](/icons/sound2.gif) | marcocks.mp3 | 2022-08-11 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | amaremix.mp3 | 2022-08-11 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | Tom Odell - Another Love (Lyrics).mp3 | 2022-08-11 13:01 | 4.4M | |
![[SND]](/icons/sound2.gif) | 2pac-2.mp3 | 2022-08-11 12:59 | 0 | |
![[SND]](/icons/sound2.gif) | White_Boy_X_Nasty_Babe_-_Dura_73283215.mp3 | 2022-08-11 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | Davin3.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | 2pac-1.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | April1.mp3 | 2022-08-11 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | Ran1.mp3 | 2022-08-11 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | MatritzenOperation (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-11 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Guyonw1.mp3 | 2022-08-11 12:49 | 936K | |
![[SND]](/icons/sound2.gif) | aa.mp3 | 2022-08-11 12:49 | 2.6M | |
![[SND]](/icons/sound2.gif) | bb.mp3 | 2022-08-11 12:48 | 836K | |
![[SND]](/icons/sound2.gif) | Mr_Lambo_Chicago_73869133.mp3 | 2022-08-11 12:46 | 0 | |
![[SND]](/icons/sound2.gif) | Duyan.mp3 | 2022-08-11 12:44 | 4.7M | |
![[SND]](/icons/sound2.gif) | misha_xramovi_-_gaichite.mp3 | 2022-08-11 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3.mp3 | 2022-08-11 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3 | 2022-08-11 12:30 | 0 | |
![[SND]](/icons/sound2.gif) | djakumeriang.mp3 | 2022-08-11 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | Rucez.mp3 | 2022-08-11 12:25 | 604K | |
![[SND]](/icons/sound2.gif) | 9N.mp3 | 2022-08-11 12:23 | 0 | |
![[SND]](/icons/sound2.gif) | 1975.mp3 | 2022-08-11 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | JJJJ.mp3 | 2022-08-11 12:18 | 1.8M | |
![[SND]](/icons/sound2.gif) | Dance13.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance12.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance11.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance10.mp3 | 2022-08-11 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Dance9.mp3 | 2022-08-11 12:10 | 2.6M | |
![[SND]](/icons/sound2.gif) | Dance8.mp3 | 2022-08-11 12:10 | 4.1M | |
![[SND]](/icons/sound2.gif) | Dance7.mp3 | 2022-08-11 12:10 | 5.6M | |
![[SND]](/icons/sound2.gif) | Dance6.mp3 | 2022-08-11 12:10 | 3.0M | |
![[SND]](/icons/sound2.gif) | Dance5.mp3 | 2022-08-11 12:10 | 4.5M | |
![[SND]](/icons/sound2.gif) | Dance4.mp3 | 2022-08-11 12:10 | 3.8M | |
![[SND]](/icons/sound2.gif) | Dance3.mp3 | 2022-08-11 12:10 | 4.2M | |
![[SND]](/icons/sound2.gif) | Dance2.mp3 | 2022-08-11 12:10 | 3.2M | |
![[SND]](/icons/sound2.gif) | Dance02.mp3 | 2022-08-11 12:09 | 2.3M | |
![[SND]](/icons/sound2.gif) | VinKy15.mp3 | 2022-08-11 11:59 | 0 | |
![[SND]](/icons/sound2.gif) | Dimas7.mp3 | 2022-08-11 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | Dimas1.mp3 | 2022-08-11 11:55 | 0 | |
![[SND]](/icons/sound2.gif) | SLK.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | NANE - DOUGH THO' 💰 (video oficial).mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | meneketehe.mp3 | 2022-08-11 11:50 | 3.8M | |
![[SND]](/icons/sound2.gif) | Yen1.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Denn1.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Denn2.mp3 | 2022-08-11 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Ek Tera Naam hai Sacha Lyrics _ ABCD2 _ Varun Dhavan __.mp3 | 2022-08-11 11:49 | 0 | |
![[SND]](/icons/sound2.gif) | Jennie.mp3 | 2022-08-11 11:46 | 0 | |
![[SND]](/icons/sound2.gif) | dkl00.mp3 | 2022-08-11 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | dkl0.mp3 | 2022-08-11 11:44 | 952K | |
![[SND]](/icons/sound2.gif) | Dimas.mp3 | 2022-08-11 11:40 | 2.9M | |
![[SND]](/icons/sound2.gif) | DimasAnjayMabar.mp3 | 2022-08-11 11:39 | 0 | |
![[SND]](/icons/sound2.gif) | [MV] Rapsodi - JKT48.mp3 | 2022-08-11 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz209.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | MACAN - Без названия.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | OGJFPGJFDPGJDOFPJG.mp3 | 2022-08-11 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | sweet_groove.mp3 | 2022-08-11 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | IMPERATOR.mp3 | 2022-08-11 11:32 | 4.9M | |
![[SND]](/icons/sound2.gif) | 7065830654449109786.mp3 | 2022-08-11 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | (FREE) Lo-fi Type Beat - I Need a Girl(MP3_160K).mp3 | 2022-08-11 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Gue Mah Bodo Amat X Aku Hamil Duluan Mengkane Viral Tiktok 2022.mp3 | 2022-08-11 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | Dance01.mp3 | 2022-08-11 11:27 | 3.0M | |
![[SND]](/icons/sound2.gif) | xRiltz1009.mp3 | 2022-08-11 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1010.mp3 | 2022-08-11 11:26 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1007.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1005.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1004.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1001.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1006.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1002.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz1003.mp3 | 2022-08-11 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | xRiltz101.mp3 | 2022-08-11 11:22 | 0 | |
![[SND]](/icons/sound2.gif) | Mother Mother - Wisdom_(audiohunter.ru).mp3 | 2022-08-11 11:18 | 0 | |
![[SND]](/icons/sound2.gif) | zaur-magomadov-idet-karavan-iz-irana.mp3 | 2022-08-11 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | Dushistyj_plan_Karavan_Ormars_remix.mp3 | 2022-08-11 11:12 | 3.8M | |
![[SND]](/icons/sound2.gif) | ilulsad5.mp3 | 2022-08-11 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | usituru.mp3 | 2022-08-11 11:07 | 1.4M | |
![[SND]](/icons/sound2.gif) | Malamini.mp3 | 2022-08-11 11:07 | 9.0M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Mahmut Orhan Ft Sena Sener Feel Extended Drop.mp3 | 2022-08-11 11:06 | 0 | |
![[SND]](/icons/sound2.gif) | jamet.mp3 | 2022-08-11 11:04 | 0 | |
![[SND]](/icons/sound2.gif) | Shiv Jan sewa.mp3 | 2022-08-11 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | bodievkruzak200spectatorremix.mp3 | 2022-08-11 11:00 | 0 | |
![[SND]](/icons/sound2.gif) | prialain.mp3 | 2022-08-11 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | ichapi5.mp3 | 2022-08-11 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | StandHereAlone.mp3 | 2022-08-11 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | Strong - One Direction (speed up version).mp3 | 2022-08-11 10:54 | 0 | |
![[SND]](/icons/sound2.gif) | ichapi4.mp3 | 2022-08-11 10:51 | 0 | |
![[SND]](/icons/sound2.gif) | danger.mp3 | 2022-08-11 10:51 | 831K | |
![[SND]](/icons/sound2.gif) | dandelions cover.mp3 | 2022-08-11 10:44 | 2.4M | |
![[SND]](/icons/sound2.gif) | kesukaan.mp3 | 2022-08-11 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Black No. 1 (Little Miss Scare -All).mp3 | 2022-08-11 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Den1.mp3 | 2022-08-11 10:43 | 2.2M | |
![[SND]](/icons/sound2.gif) | Fav1.mp3 | 2022-08-11 10:42 | 1.0M | |
![[SND]](/icons/sound2.gif) | Jastin.mp3 | 2022-08-11 10:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | fsijfs.mp3 | 2022-08-11 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | DUST.mp3 | 2022-08-11 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | SDFJSDF.mp3 | 2022-08-11 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | (downloadlagu321z.net) - TRICKSTER TILL I DIED - Prod.By MANGBORIS (Official Audio) (1).mp3 | 2022-08-11 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | remix1.mp3 | 2022-08-11 10:22 | 2.7M | |
![[SND]](/icons/sound2.gif) | Jokoti(4).mp3 | 2022-08-11 10:19 | 0 | |
![[SND]](/icons/sound2.gif) | Jack.mp3 | 2022-08-11 10:18 | 0 | |
![[SND]](/icons/sound2.gif) | P9.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | MNUEIW.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | Farel Prayoga Satru 2.mp3 | 2022-08-11 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | SAD1111.mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Orange.mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Jokoti(2).mp3 | 2022-08-11 10:12 | 0 | |
![[SND]](/icons/sound2.gif) | Y6mta.mp3 | 2022-08-11 10:10 | 0 | |
![[SND]](/icons/sound2.gif) | muli (2).mp3 | 2022-08-11 10:08 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Fisto-B-Itz-EnRouteHouse120.mp3 | 2022-08-11 10:07 | 4.4M | |
![[SND]](/icons/sound2.gif) | kg.mp3 | 2022-08-11 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | nowbita.mp3 | 2022-08-11 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | P1.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Nobita.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | KayGanda.mp3 | 2022-08-11 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | kumpas.mp3 | 2022-08-11 10:00 | 2.0M | |
![[SND]](/icons/sound2.gif) | Re-Up.mp3 | 2022-08-11 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Moira Dela Torre - Kumpas (Official Lyric Visualizer) (1).mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Marko Rudio - Ikaw lang (Nobita) cover.mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Muli- Ace Banzuelo drum cover.mp3 | 2022-08-11 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | enak.mp3 | 2022-08-11 09:55 | 3.3M | |
![[SND]](/icons/sound2.gif) | m52.mp3 | 2022-08-11 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | m51.mp3 | 2022-08-11 09:55 | 0 | |
![[SND]](/icons/sound2.gif) | Black Mirror Soundtrack Hang the Dj - Hours, Days, Months.mp3 | 2022-08-11 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Cash Cash-Hero.mp3 | 2022-08-11 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | sakit.mp3 | 2022-08-11 09:52 | 3.5M | |
![[SND]](/icons/sound2.gif) | Comment.mp3 | 2022-08-11 09:51 | 2.6M | |
![[SND]](/icons/sound2.gif) | Cash Cash - Hero feat. Christina Perri [Official Audio].mp3 | 2022-08-11 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Aku meriang.mp3 | 2022-08-11 09:42 | 2.3M | |
![[SND]](/icons/sound2.gif) | AUD-20220811-WA0000.mp3 | 2022-08-11 09:39 | 0 | |
![[SND]](/icons/sound2.gif) | DJ.AKU MERIANG MERINDUKAN KASIH SAYANG CITATA VIRAL TIKTOK fyptiktok 🎧.mp3 | 2022-08-11 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | 【明白神的旨意】第2讲(上半部分).mp3 | 2022-08-11 09:28 | 0 | |
![[SND]](/icons/sound2.gif) | mashup.mp3 | 2022-08-11 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Sound Yang Lagi Viral Di TikTok RizkiSz Dj Midua Cinta Mengkane Bootleg Raka Remixer.mp3 | 2022-08-11 09:24 | 0 | |
![[SND]](/icons/sound2.gif) | Destroy_Lonely_-_Loyalti.mp3 | 2022-08-11 09:18 | 0 | |
![[SND]](/icons/sound2.gif) | promqueen.mp3 | 2022-08-11 09:17 | 2.0M | |
![[SND]](/icons/sound2.gif) | prom queen.mp3 | 2022-08-11 09:16 | 1.9M | |
![[SND]](/icons/sound2.gif) | X2Download.mp3 | 2022-08-11 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi9.mp3 | 2022-08-11 09:13 | 0 | |
![[SND]](/icons/sound2.gif) | Duo.mp3 | 2022-08-11 09:12 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi7.mp3 | 2022-08-11 09:10 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi8.mp3 | 2022-08-11 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | Vamos.mp3 | 2022-08-11 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - HUYỀN TÂM MÔN LẦN HẸN HÒ ĐẦU TIÊN Prod BEGINNING OFFICIAL AUDIO.mp3 | 2022-08-11 09:04 | 0 | |
![[SND]](/icons/sound2.gif) | duran-ozer-siki-baba.mp3 | 2022-08-11 09:02 | 0 | |
![[VID]](/icons/movie.gif) | اغنية كردية ريمكس عشقه ملايين من الأكراد سوراني (كوردمو كوردستانيم).mp4 | 2022-08-11 09:01 | 0 | |
![[SND]](/icons/sound2.gif) | John124.mp3 | 2022-08-11 08:56 | 2.0M | |
![[SND]](/icons/sound2.gif) | 0001.mp3 | 2022-08-11 08:55 | 0 | |
![[SND]](/icons/sound2.gif) | V.mp3 | 2022-08-11 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_256kbps.mp3 | 2022-08-11 08:52 | 0 | |
![[SND]](/icons/sound2.gif) | zxen3.mp3 | 2022-08-11 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi3.mp3 | 2022-08-11 08:48 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi2.mp3 | 2022-08-11 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Umb.mp3 | 2022-08-11 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Pogi1.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | Yaukoshi, LXST CXNTURY Цой - Кончится Odium.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | kurd1.mp3 | 2022-08-11 08:46 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_96kbps.mp3 | 2022-08-11 08:44 | 0 | |
![[SND]](/icons/sound2.gif) | AR23.mp3 | 2022-08-11 08:41 | 0 | |
![[SND]](/icons/sound2.gif) | gio-pika-fontanchik-s-chernym-delfinom(mp3name.co).mp3 | 2022-08-11 08:40 | 0 | |
![[VID]](/icons/movie.gif) | VN20220511_184453_001.mp4 | 2022-08-11 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | DjSleep82.mp3 | 2022-08-11 08:35 | 0 | |
![[SND]](/icons/sound2.gif) | KINO_-_Zakrojj_za_mnojj_dver_ya_ukhozhu_(musmore.com).mp3 | 2022-08-11 08:34 | 0 | |
![[SND]](/icons/sound2.gif) | Кино - Закрой за мной дверь я ухожу.mp3 | 2022-08-11 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | AR1.mp3 | 2022-08-11 08:33 | 0 | |
![[SND]](/icons/sound2.gif) | E.C. 2151 - Demon's Tilt.mp3 | 2022-08-11 08:31 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra5.mp3 | 2022-08-11 08:27 | 0 | |
![[SND]](/icons/sound2.gif) | djdesa81.mp3 | 2022-08-11 08:23 | 0 | |
![[SND]](/icons/sound2.gif) | banding.mp3 | 2022-08-11 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | DJ TANGKIS DAANG X PAPALI BERNYANYI SOUND MAHA TREND TAHUN LAHIR VIRAL TIKTOK.mp3 | 2022-08-11 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp3.mp3 | 2022-08-11 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | Keizaro2.mp3 | 2022-08-11 08:18 | 3.8M | |
![[SND]](/icons/sound2.gif) | Keizaro5.mp3 | 2022-08-11 08:18 | 4.2M | |
![[SND]](/icons/sound2.gif) | Keizaro4.mp3 | 2022-08-11 08:17 | 3.8M | |
![[SND]](/icons/sound2.gif) | Keizaro9.mp3 | 2022-08-11 08:17 | 3.1M | |
![[SND]](/icons/sound2.gif) | Keizaro11.mp3 | 2022-08-11 08:17 | 2.8M | |
![[SND]](/icons/sound2.gif) | Wrrp4.mp3 | 2022-08-11 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp6.mp3 | 2022-08-11 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | Powfu - Death Bed (8D Audio Lyrics) feat. Beabadoobee dont stay away for to.mp3 | 2022-08-11 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | Wrrp1.mp3 | 2022-08-11 08:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - Nonstop 2022 - I Don't Know Her Name Remix - Nhạc Hot Trend Xu Hướng Tik Tok 2022 (320 kbps).mp3 | 2022-08-11 08:14 | 1.1M | |
![[SND]](/icons/sound2.gif) | R.I.P.mp3 | 2022-08-11 08:14 | 2.8M | |
![[SND]](/icons/sound2.gif) | Sakit Gigi.mp3 | 2022-08-11 08:13 | 5.5M | |
![[SND]](/icons/sound2.gif) | letiteat.mp3 | 2022-08-11 08:12 | 1.3M | |
![[SND]](/icons/sound2.gif) | pakpong.mp3 | 2022-08-11 08:11 | 496K | |
![[SND]](/icons/sound2.gif) | Boom.mp3 | 2022-08-11 08:10 | 24K | |
![[SND]](/icons/sound2.gif) | Cewo_-_Underworld_Remix_low_bass_by_ed4et_73431420.mp3 | 2022-08-11 08:08 | 0 | |
![[SND]](/icons/sound2.gif) | myoops.mp3 | 2022-08-11 08:04 | 3.5M | |
![[SND]](/icons/sound2.gif) | Thotiana.mp3 | 2022-08-11 08:04 | 2.0M | |
![[SND]](/icons/sound2.gif) | tr1.mp3 | 2022-08-11 07:54 | 15M | |
![[SND]](/icons/sound2.gif) | SHokk_-_Mne_tebe_nechego_skazat_prosti_no_ty_ne_pojmyosh_Tot_zhar_i_zhazhda_izchezli_ostalas_syrost_(iPleer.com).mp3 | 2022-08-11 07:53 | 4.6M | |
![[SND]](/icons/sound2.gif) | Kung_Ikay_Akin_-_Lyrics_by_Chocolate_Factory_[ConverteZilla.com].mp3 | 2022-08-11 07:52 | 3.8M | |
![[SND]](/icons/sound2.gif) | djkane2.mp3 | 2022-08-11 07:48 | 37M | |
![[SND]](/icons/sound2.gif) | fn.mp3 | 2022-08-11 07:47 | 5.2M | |
![[SND]](/icons/sound2.gif) | JoJo-Allopening_(allmp3.su).mp3 | 2022-08-11 07:46 | 16M | |
![[SND]](/icons/sound2.gif) | Anjay.mp3 | 2022-08-11 07:46 | 4.3M | |
![[SND]](/icons/sound2.gif) | aty.mp3 | 2022-08-11 07:45 | 8.8M | |
![[SND]](/icons/sound2.gif) | это.mp3 | 2022-08-11 07:43 | 9.3M | |
![[SND]](/icons/sound2.gif) | djkane1.mp3 | 2022-08-11 07:42 | 3.9M | |
![[SND]](/icons/sound2.gif) | sad01.mp3 | 2022-08-11 07:40 | 0 | |
![[SND]](/icons/sound2.gif) | это.mp3.mp3 | 2022-08-11 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | Heartbreaking.mp3.mp3 | 2022-08-11 07:37 | 0 | |
![[SND]](/icons/sound2.gif) | djnioi.mp3 | 2022-08-11 07:37 | 0 | |
![[SND]](/icons/sound2.gif) | Teki.mp3 | 2022-08-11 07:33 | 0 | |
![[SND]](/icons/sound2.gif) | djkane.mp3 | 2022-08-11 07:32 | 212K | |
![[SND]](/icons/sound2.gif) | frien.mp3 | 2022-08-11 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | fonovaja_muzika_dlja_video4_-_bez_nazvanija_(z2.fm).mp3 | 2022-08-11 07:28 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi & Andy Panda - Патрн.mp3 | 2022-08-11 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | bt.mp3 | 2022-08-11 07:23 | 764K | |
![[SND]](/icons/sound2.gif) | KGC.mp3 | 2022-08-11 07:21 | 0 | |
![[SND]](/icons/sound2.gif) | orang.mp3 | 2022-08-11 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | willrain.mp3 | 2022-08-11 07:19 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE.mp3 | 2022-08-11 07:19 | 3.8M | |
![[SND]](/icons/sound2.gif) | The Purge - Announcement HD.mp3 | 2022-08-11 07:15 | 0 | |
![[SND]](/icons/sound2.gif) | Sanaallmahal.mp3 | 2022-08-11 07:05 | 1.5M | |
![[SND]](/icons/sound2.gif) | Simulashan.mp3 | 2022-08-11 07:02 | 2.8M | |
![[SND]](/icons/sound2.gif) | Halakashan.mp3 | 2022-08-11 07:02 | 2.1M | |
![[SND]](/icons/sound2.gif) | Kagome.mp3 | 2022-08-11 06:59 | 3.7M | |
![[SND]](/icons/sound2.gif) | 9naga.mp3 | 2022-08-11 06:59 | 906K | |
![[SND]](/icons/sound2.gif) | Holdme.mp3 | 2022-08-11 06:59 | 3.3M | |
![[SND]](/icons/sound2.gif) | JJ.mp3 | 2022-08-11 06:59 | 1.7M | |
![[SND]](/icons/sound2.gif) | J.mp3 | 2022-08-11 06:58 | 1.2M | |
![[SND]](/icons/sound2.gif) | Halik.mp3 | 2022-08-11 06:58 | 4.2M | |
![[SND]](/icons/sound2.gif) | Guns.mp3 | 2022-08-11 06:58 | 5.0M | |
![[SND]](/icons/sound2.gif) | Hero.mp3 | 2022-08-11 06:58 | 1.7M | |
![[SND]](/icons/sound2.gif) | Heathens.mp3 | 2022-08-11 06:58 | 3.3M | |
![[SND]](/icons/sound2.gif) | Heather.mp3 | 2022-08-11 06:58 | 2.7M | |
![[SND]](/icons/sound2.gif) | Heart.mp3 | 2022-08-11 06:58 | 2.4M | |
![[SND]](/icons/sound2.gif) | Dreams.mp3 | 2022-08-11 06:57 | 3.3M | |
![[SND]](/icons/sound2.gif) | Easyonme.mp3 | 2022-08-11 06:57 | 3.4M | |
![[SND]](/icons/sound2.gif) | end.mp3 | 2022-08-11 06:57 | 3.3M | |
![[SND]](/icons/sound2.gif) | Ganonparen.mp3 | 2022-08-11 06:57 | 2.7M | |
![[SND]](/icons/sound2.gif) | Datingtayo.mp3 | 2022-08-11 06:57 | 3.9M | |
![[SND]](/icons/sound2.gif) | Dope.mp3 | 2022-08-11 06:56 | 3.2M | |
![[SND]](/icons/sound2.gif) | Неизвестен — Зачем она берёт мужские письки в рот (www.lightaudio.ru) (1).mp3 | 2022-08-11 06:56 | 1.1M | |
![[SND]](/icons/sound2.gif) | Easy.mp3 | 2022-08-11 06:56 | 127K | |
![[SND]](/icons/sound2.gif) | Again.mp3 | 2022-08-11 06:56 | 3.1M | |
![[SND]](/icons/sound2.gif) | Broken.mp3 | 2022-08-11 06:56 | 2.4M | |
![[SND]](/icons/sound2.gif) | keduoitheoanhsang.mp3 | 2022-08-11 06:56 | 0 | |
![[SND]](/icons/sound2.gif) | Bed.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | ACDMND.mp3 | 2022-08-11 06:55 | 4.6M | |
![[SND]](/icons/sound2.gif) | blue.mp3 | 2022-08-11 06:55 | 2.3M | |
![[SND]](/icons/sound2.gif) | balls.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | Atlantic.mp3 | 2022-08-11 06:55 | 2.7M | |
![[SND]](/icons/sound2.gif) | zone.mp3 | 2022-08-11 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | Dj3.mp3 | 2022-08-11 06:51 | 1.8M | |
![[SND]](/icons/sound2.gif) | naga.mp3 | 2022-08-11 06:51 | 0 | |
![[SND]](/icons/sound2.gif) | mikee2.mp3 | 2022-08-11 06:47 | 0 | |
![[SND]](/icons/sound2.gif) | 02.Mon_Bojhe_Na-Arijit_Singh_FusionBD.Com.mp3 | 2022-08-11 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | Relax.mp3 | 2022-08-11 06:42 | 580K | |
![[SND]](/icons/sound2.gif) | ms.mp3 | 2022-08-11 06:40 | 3.3M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D.mp3 | 2022-08-11 06:26 | 0 | |
![[SND]](/icons/sound2.gif) | gonefludd_-_kubik_lda_(zf.fm).mp3 | 2022-08-11 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | ecec2.mp3 | 2022-08-11 06:19 | 0 | |
![[SND]](/icons/sound2.gif) | Marko1.mp3 | 2022-08-11 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | 0608_525f_0159_1b9ea4ee07e5c709f0f2633181f994e0.mp3 | 2022-08-11 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | _Mohabbat_Barsa_De__Full_Video_Song_Ft._Arjun___Creature_3D,_Surveen_Chawla_.mp3 | 2022-08-11 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D_320kbps.mp3 | 2022-08-11 06:13 | 0 | |
![[SND]](/icons/sound2.gif) | 02.Honved Ensemble - 02 A Nyugati Gregorian Es A Magyar Nepdal Talalkozasa.mp3 | 2022-08-11 06:11 | 0 | |
![[SND]](/icons/sound2.gif) | james19.mp3 | 2022-08-11 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | james20.mp3 | 2022-08-11 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | HAR10.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR13.mp3 | 2022-08-11 06:09 | 4.4M | |
![[SND]](/icons/sound2.gif) | Kobo7.mp3 | 2022-08-11 06:09 | 943K | |
![[SND]](/icons/sound2.gif) | HAR4.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR5.mp3 | 2022-08-11 06:09 | 0 | |
![[SND]](/icons/sound2.gif) | HAR6.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR7.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR8.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | HAR9.mp3 | 2022-08-11 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | lil_bank_-_LVL_drift_fonk_Bassbust_(TheMP3.Info).mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har14.mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har13.mp3 | 2022-08-11 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Har12.mp3 | 2022-08-11 06:06 | 0 | |
![[SND]](/icons/sound2.gif) | AniSh-MaHli-New-Nagpuri-Bewafa-Song-2022-Dj-Nagpuri-Song-2022-Dj-Pawan-Bedia_2q5yhjZC7uI.mp3 | 2022-08-11 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | Yh.mp3 | 2022-08-11 06:02 | 3.9M | |
![[SND]](/icons/sound2.gif) | Tandi1.mp3 | 2022-08-11 06:02 | 0 | |
![[SND]](/icons/sound2.gif) | C5162.mp3 | 2022-08-11 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | Close55.mp3 | 2022-08-11 06:00 | 0 | |
![[SND]](/icons/sound2.gif) | s7.mp3 | 2022-08-11 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | ayaayi.mp3 | 2022-08-11 05:53 | 0 | |
![[SND]](/icons/sound2.gif) | you_win_1.mp3 | 2022-08-11 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | misel.mp3 | 2022-08-11 05:48 | 388K | |
![[SND]](/icons/sound2.gif) | DJ Meneketehe VinKy ft. Abub YETE.mp3 | 2022-08-11 05:45 | 3.8M | |
![[SND]](/icons/sound2.gif) | Cosmo Sheldrake - Nightjar Wake up Call.mp3 | 2022-08-11 05:41 | 0 | |
![[SND]](/icons/sound2.gif) | Sadrrt.mp3 | 2022-08-11 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | theweeknd.mp3 | 2022-08-11 05:40 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy10.mp3 | 2022-08-11 05:39 | 3.1M | |
![[SND]](/icons/sound2.gif) | Shower again.m4a | 2022-08-11 05:37 | 142K | |
![[SND]](/icons/sound2.gif) | Iwas1.mp3 | 2022-08-11 05:36 | 0 | |
![[SND]](/icons/sound2.gif) | 245.mp3 | 2022-08-11 05:34 | 0 | |
![[SND]](/icons/sound2.gif) | hoh.mp3 | 2022-08-11 05:34 | 0 | |
![[SND]](/icons/sound2.gif) | hohh.mp3 | 2022-08-11 05:34 | 2.1M | |
![[SND]](/icons/sound2.gif) | Iwas.mp3 | 2022-08-11 05:33 | 0 | |
![[SND]](/icons/sound2.gif) | Wednesdaysex.m4a | 2022-08-11 05:33 | 280K | |
![[SND]](/icons/sound2.gif) | SIARAN ONLINE Mixdown 1.mp3 | 2022-08-11 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | ketche.mp3 | 2022-08-11 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | mybrother.mp3 | 2022-08-11 05:26 | 0 | |
![[SND]](/icons/sound2.gif) | FileMorphOutput.mp3 | 2022-08-11 05:22 | 0 | |
![[SND]](/icons/sound2.gif) | 4_6010582219926544407.mp3 | 2022-08-11 05:08 | 0 | |
![[SND]](/icons/sound2.gif) | 4_6014999348977342305.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | Alvino.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | Фая.mp3 | 2022-08-11 05:07 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]DJ KU HAMIL DULUAN REMIX __ VIRAL TIKTOK.itL8liAGKro.mp3 | 2022-08-11 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | rzali.mp3 | 2022-08-11 05:03 | 0 | |
![[SND]](/icons/sound2.gif) | zz.mp3 | 2022-08-11 05:02 | 2.4M | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Japanese Guy Yelling-UpjYTwNjWc8-160k-1660193861394-[AudioTrimmer.com].mp3 | 2022-08-11 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | elsakane5.mp3 | 2022-08-11 04:59 | 0 | |
![[SND]](/icons/sound2.gif) | HARAM.mp3 | 2022-08-11 04:54 | 1.9M | |
![[SND]](/icons/sound2.gif) | Kobo8.mp3 | 2022-08-11 04:48 | 2.7M | |
![[SND]](/icons/sound2.gif) | Kobo4.mp3 | 2022-08-11 04:45 | 0 | |
![[SND]](/icons/sound2.gif) | yy.mp3 | 2022-08-11 04:39 | 3.4M | |
![[SND]](/icons/sound2.gif) | ERIKA1.mp3 | 2022-08-11 04:38 | 0 | |
![[SND]](/icons/sound2.gif) | xy.mp3 | 2022-08-11 04:37 | 0 | |
![[SND]](/icons/sound2.gif) | xx.mp3 | 2022-08-11 04:33 | 3.3M | |
![[SND]](/icons/sound2.gif) | SEYNONSTOP.mp3 | 2022-08-11 04:33 | 0 | |
![[SND]](/icons/sound2.gif) | tw.mp3 | 2022-08-11 04:31 | 0 | |
![[SND]](/icons/sound2.gif) | Week 2 Support.mp3 | 2022-08-11 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Week 3 Support.mp3 | 2022-08-11 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Week 4 Support.mp3 | 2022-08-11 04:27 | 1.7M | |
![[SND]](/icons/sound2.gif) | Week 1 Support.mp3 | 2022-08-11 04:26 | 0 | |
![[SND]](/icons/sound2.gif) | mgc.mp3 | 2022-08-11 04:25 | 0 | |
![[SND]](/icons/sound2.gif) | Sey2.mp3 | 2022-08-11 04:25 | 0 | |
![[SND]](/icons/sound2.gif) | Bimbo.mp3 | 2022-08-11 04:23 | 0 | |
![[SND]](/icons/sound2.gif) | Rain.mp3 | 2022-08-11 04:22 | 924K | |
![[SND]](/icons/sound2.gif) | KANECOK.mp3 | 2022-08-11 04:20 | 0 | |
![[SND]](/icons/sound2.gif) | industry.mp3 | 2022-08-11 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | specret.mp3 | 2022-08-11 04:14 | 0 | |
![[SND]](/icons/sound2.gif) | Daa.mp3 | 2022-08-11 04:11 | 3.3M | |
![[SND]](/icons/sound2.gif) | KG _ Nik Makino ( Lyrics ).mp3 | 2022-08-11 04:11 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lil Nas X HOLIDAY Official Video.mp3 | 2022-08-11 04:08 | 0 | |
![[SND]](/icons/sound2.gif) | CORRUPTION - 101 OST.mp3 | 2022-08-11 04:07 | 0 | |
![[SND]](/icons/sound2.gif) | Високосный Год - Тихий Огонек.mp3 | 2022-08-11 04:03 | 0 | |
![[SND]](/icons/sound2.gif) | djviral.mp3 | 2022-08-11 04:03 | 3.8M | |
![[SND]](/icons/sound2.gif) | СИНИЕ ФИАЛКИ - The Limba (1).m4a | 2022-08-11 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | Sey1.mp3 | 2022-08-11 04:02 | 0 | |
![[SND]](/icons/sound2.gif) | Sey5.mp3 | 2022-08-11 03:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sey4.mp3 | 2022-08-11 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | Sey3.mp3 | 2022-08-11 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | walk with me1.mp3 | 2022-08-11 03:55 | 272K | |
![[SND]](/icons/sound2.gif) | Super boom 2019 Dj Ciray Nonstop bass cực phiêu.mp3 | 2022-08-11 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | MIGUELA.mp3 | 2022-08-11 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Hbpasyon123.mp3 | 2022-08-11 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | happy birthday remix 2021 _ happy birthday to you _ happy birthday techno budots 2021.mp3 | 2022-08-11 03:45 | 0 | |
![[SND]](/icons/sound2.gif) | audio.mp3 | 2022-08-11 03:42 | 544K | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lỡ Yêu Người Đậm Sâu Lofi Ver Linh Hương Luz Cánh Hoa tàn tình tan và em bay theo gió ngàn_320kbps.mp3 | 2022-08-11 03:42 | 1.4M | |
![[SND]](/icons/sound2.gif) | funkot.mp3 | 2022-08-11 03:40 | 1.5M | |
![[SND]](/icons/sound2.gif) | BILAL1.mp3 | 2022-08-11 03:38 | 2.9M | |
![[SND]](/icons/sound2.gif) | Kira1123.mp3 | 2022-08-11 03:38 | 0 | |
![[SND]](/icons/sound2.gif) | Proyecto TQ - Fuego (OST Сыны анархии 5 сезон).mp3 | 2022-08-11 03:36 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Tương Tư Nan Tuyệt Remix Đại Thần Tuệ Top 10 Bài hát TikTok MỚI NHẤT tuần vừa qua AML MUSIC.mp3 | 2022-08-11 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | hbpasyon.mp3 | 2022-08-11 03:33 | 0 | |
![[SND]](/icons/sound2.gif) | dj6.mp3 | 2022-08-11 03:31 | 436K | |
![[SND]](/icons/sound2.gif) | HBkira1.mp3 | 2022-08-11 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Lãng Tử Nhàn Thoại Thiên Tú HM Remix Thái Quỳnh Cover Hot Tiktok 2020.mp3 | 2022-08-11 03:24 | 3.9M | |
![[SND]](/icons/sound2.gif) | Virgoun - Surat Cinta Untuk Starla (Official Lyric Video).mp3 | 2022-08-11 03:24 | 4.2M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Perfect Ed Sheeran Lyrics.mp3 | 2022-08-11 03:21 | 0 | |
![[SND]](/icons/sound2.gif) | TIIL I DIE1.mp3 | 2022-08-11 03:19 | 0 | |
![[SND]](/icons/sound2.gif) | sanji01.mp3 | 2022-08-11 03:13 | 0 | |
![[SND]](/icons/sound2.gif) | djkedua.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | kurdhell.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | kedua.mp3 | 2022-08-11 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | egk.mp3 | 2022-08-11 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | sunami1.mp3 | 2022-08-11 03:09 | 0 | |
![[SND]](/icons/sound2.gif) | ygkedua.mp3 | 2022-08-11 03:05 | 0 | |
![[SND]](/icons/sound2.gif) | (01) [Ray Manzarek] Too Close To The Sun.mp3 | 2022-08-11 03:03 | 0 | |
![[SND]](/icons/sound2.gif) | jadikan.mp3 | 2022-08-11 03:01 | 0 | |
![[SND]](/icons/sound2.gif) | mcrp.mp3 | 2022-08-11 02:53 | 0 | |
![[SND]](/icons/sound2.gif) | Qwerty.mp3 | 2022-08-11 02:50 | 0 | |
![[SND]](/icons/sound2.gif) | Smp1.mp3 | 2022-08-11 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | 345345.mp3 | 2022-08-11 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | 123123.mp3 | 2022-08-11 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | Smile.mp3 | 2022-08-11 02:22 | 0 | |
![[SND]](/icons/sound2.gif) | Come.mp3 | 2022-08-11 02:17 | 4.1M | |
![[SND]](/icons/sound2.gif) | Buhay.mp3 | 2022-08-11 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | Myself.mp3 | 2022-08-11 02:14 | 0 | |
![[SND]](/icons/sound2.gif) | Lorna Shore - To the Hellfire.mp3 | 2022-08-11 02:13 | 444K | |
![[SND]](/icons/sound2.gif) | mrp.mp3 | 2022-08-11 02:13 | 227K | |
![[SND]](/icons/sound2.gif) | jaya.mp3 | 2022-08-11 02:10 | 1.1M | |
![[SND]](/icons/sound2.gif) | 05 Montreux Inventions.mp3 | 2022-08-11 02:09 | 1.5M | |
![[SND]](/icons/sound2.gif) | (MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp3.mp3 | 2022-08-11 02:06 | 0 | |
![[SND]](/icons/sound2.gif) | MURDER.mp3 | 2022-08-11 01:59 | 0 | |
![[SND]](/icons/sound2.gif) | Har22.mp3 | 2022-08-11 01:57 | 0 | |
![[SND]](/icons/sound2.gif) | Har21.mp3 | 2022-08-11 01:57 | 0 | |
![[SND]](/icons/sound2.gif) | DODI.mp3 | 2022-08-11 01:53 | 0 | |
![[SND]](/icons/sound2.gif) | Makeawishnct.mp3 | 2022-08-11 01:47 | 0 | |
![[SND]](/icons/sound2.gif) | Make a wish nct.mp3 | 2022-08-11 01:44 | 0 | |
![[SND]](/icons/sound2.gif) | Marko7.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko5.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko3.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko2.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Marko4.mp3 | 2022-08-11 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Dangdut1.mp3 | 2022-08-11 01:40 | 0 | |
![[SND]](/icons/sound2.gif) | KNTL.mp3 | 2022-08-11 01:39 | 1.3M | |
![[SND]](/icons/sound2.gif) | JOKOTINGKIR.mp3 | 2022-08-11 01:37 | 0 | |
![[SND]](/icons/sound2.gif) | The Weeknd - Is There Someone Else (Official Audio).mp3 | 2022-08-11 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | Die For You.mp3 | 2022-08-11 01:33 | 4.0M | |
![[SND]](/icons/sound2.gif) | YUMMY_7 (2).mp3 | 2022-08-11 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | djogi.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | power.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | NCTUMake_A_Wish_Birthday_Song_MV_tyrVtwE8Gv0_140.mp3s.mp3 | 2022-08-11 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | morning-with-coffee-loop_GytAO4Eu.mp3 | 2022-08-11 01:20 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-11 at 08.13.48.mp3s.mp3 | 2022-08-11 01:16 | 340K | |
![[SND]](/icons/sound2.gif) | lian.mp3 | 2022-08-11 01:04 | 0 | |
![[SND]](/icons/sound2.gif) | ADLIN_-_Dead_Inside_73224409.mp3 | 2022-08-11 00:59 | 0 | |
![[SND]](/icons/sound2.gif) | Lagi1.mp3 | 2022-08-11 00:56 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - Hari ini hari ulang tahunmu Mentahan LirikAesthetic .mp3 | 2022-08-11 00:55 | 0 | |
![[SND]](/icons/sound2.gif) | momong.mp3 | 2022-08-11 00:50 | 0 | |
![[SND]](/icons/sound2.gif) | pizzapastaputitinabox.mp3 | 2022-08-11 00:47 | 0 | |
![[SND]](/icons/sound2.gif) | 8sec.mp3 | 2022-08-11 00:38 | 0 | |
![[SND]](/icons/sound2.gif) | ACDC_-_Back_In_Black_47830042.mp3 | 2022-08-11 00:38 | 892K | |
![[SND]](/icons/sound2.gif) | 🎧🎶DJ GOLDEN CROWN BREAKBEAT VIRAL TIKTOK YANG DI CARI!!🎶🎧.mp3 | 2022-08-11 00:33 | 0 | |
![[SND]](/icons/sound2.gif) | dj eyes.mp3 | 2022-08-11 00:33 | 0 | |
![[SND]](/icons/sound2.gif) | Day89.mp3 | 2022-08-11 00:32 | 0 | |
![[SND]](/icons/sound2.gif) | macarena2.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | DJ BASS BETON OLEJON OLEJON X OCOPAKELE PARTY KELUD ALL TALENT NEW REMIX.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | Dj karena kamu dj tiktok terbaru 2021 karena kamu.mp3 | 2022-08-11 00:31 | 0 | |
![[SND]](/icons/sound2.gif) | duyz.mp3 | 2022-08-11 00:30 | 0 | |
![[SND]](/icons/sound2.gif) | Words30.mp3 | 2022-08-11 00:28 | 0 | |
![[SND]](/icons/sound2.gif) | samuel_oayk.mp3 | 2022-08-11 00:26 | 0 | |
![[SND]](/icons/sound2.gif) | no.mp3 | 2022-08-11 00:21 | 256K | |
![[SND]](/icons/sound2.gif) | Yeni proje.mp3 | 2022-08-11 00:21 | 0 | |
![[SND]](/icons/sound2.gif) | after dark — mr.kitty (lyrics).mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | DJ PAPA LIAT AKU BERNYANYI X PAPEPAP REMIX FULLBASS TERBARU.mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | Twenty_One_Pilots_x_Stranger_Things_(getmp3.pro).mp3 | 2022-08-11 00:14 | 0 | |
![[SND]](/icons/sound2.gif) | Hoy.mp3 | 2022-08-11 00:08 | 0 | |
![[VID]](/icons/movie.gif) | PA.mp4 | 2022-08-11 00:06 | 0 | |
![[SND]](/icons/sound2.gif) | LAGU.mp3 | 2022-08-10 23:54 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp-Ptt-2022-08-10-at-20.38.00.mp3 | 2022-08-10 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Ds39.mp3 | 2022-08-10 23:44 | 0 | |
![[SND]](/icons/sound2.gif) | Jokoti.mp3 | 2022-08-10 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik.mp3 | 2022-08-10 23:27 | 0 | |
![[SND]](/icons/sound2.gif) | nonton.mp3 | 2022-08-10 23:27 | 0 | |
![[SND]](/icons/sound2.gif) | DENNY CAKNAN X HAPPY ASMARA - SATRU 2 ( Offical Li.mp3 | 2022-08-10 23:26 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - حلمي تحطم واختفى اغنية مؤثرة وجميلة AMV Ahlam song IZZ ft Emy Hetari لا تفوتك.mp3 | 2022-08-10 23:13 | 0 | |
![[SND]](/icons/sound2.gif) | ЛИТВИНЕНКО - Чёрные птицы.mp3 | 2022-08-10 22:58 | 0 | |
![[SND]](/icons/sound2.gif) | nokomen.mp3 | 2022-08-10 22:57 | 0 | |
![[SND]](/icons/sound2.gif) | Arturo Mejia Virtual Pros audio.mp3 | 2022-08-10 22:55 | 0 | |
![[SND]](/icons/sound2.gif) | dj takkan.mp3 | 2022-08-10 22:43 | 0 | |
![[SND]](/icons/sound2.gif) | easy11.mp3 | 2022-08-10 22:40 | 0 | |
![[SND]](/icons/sound2.gif) | djsm-robbe-frank-moody 3sec.mp3 | 2022-08-10 22:35 | 0 | |
![[SND]](/icons/sound2.gif) | - Sēnes (320kbps) (mp3cut.net).mp3 | 2022-08-10 22:29 | 0 | |
![[SND]](/icons/sound2.gif) | Neil Cicierega - Bega Interlude (2).mp3 | 2022-08-10 22:27 | 0 | |
![[SND]](/icons/sound2.gif) | Glooco.mp3 | 2022-08-10 22:24 | 3.9M | |
![[SND]](/icons/sound2.gif) | Glouco.mp3 | 2022-08-10 22:23 | 0 | |
![[SND]](/icons/sound2.gif) | Neil Cicierega - Bega Interlude.mp3 | 2022-08-10 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | X-WAYNE, SH3TLVIZ - RAMPAGE.mp3 | 2022-08-10 22:17 | 0 | |
![[SND]](/icons/sound2.gif) | GnL2.mp3 | 2022-08-10 22:14 | 0 | |
![[SND]](/icons/sound2.gif) | GnL1.mp3 | 2022-08-10 22:13 | 0 | |
![[SND]](/icons/sound2.gif) | memetj.mp3 | 2022-08-10 22:12 | 0 | |
![[SND]](/icons/sound2.gif) | Arabic Nokia Type Beat.mp3 | 2022-08-10 22:11 | 0 | |
![[SND]](/icons/sound2.gif) | ROXIE1.mp3 | 2022-08-10 22:10 | 0 | |
![[SND]](/icons/sound2.gif) | DEAD_BLONDE_-_Malchik_Na_Devyatke_70892133.mp3 | 2022-08-10 22:09 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi& Эндшпильfeat.Ре.mp3 | 2022-08-10 22:07 | 0 | |
![[SND]](/icons/sound2.gif) | SEDIH2.mp3 | 2022-08-10 22:06 | 0 | |
![[SND]](/icons/sound2.gif) | Sad5.mp3 | 2022-08-10 22:06 | 0 | |
![[SND]](/icons/sound2.gif) | Chepz.mp3 | 2022-08-10 22:04 | 0 | |
![[SND]](/icons/sound2.gif) | SAD6.mp3 | 2022-08-10 22:02 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660161295319 (2).mp3 | 2022-08-10 22:00 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1660161295319.mp3 | 2022-08-10 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | Sedih6.mp3 | 2022-08-10 21:59 | 0 | |
![[SND]](/icons/sound2.gif) | Delusi.mp3 | 2022-08-10 21:56 | 0 | |
![[SND]](/icons/sound2.gif) | DEAD BLONDE - Мальчик на девятке.mp3 | 2022-08-10 21:39 | 8.2M | |
![[SND]](/icons/sound2.gif) | ojoban.mp3 | 2022-08-10 21:34 | 0 | |
![[SND]](/icons/sound2.gif) | szum.mp3 | 2022-08-10 21:30 | 0 | |
![[SND]](/icons/sound2.gif) | Wenaro, Lxner - Лёд.mp3 | 2022-08-10 21:30 | 0 | |
![[SND]](/icons/sound2.gif) | den_vau_tong_hop_nhung_bai_hat_hay_nhat_cua_den_vau_2022_2212807356951642854 (1).mp3 | 2022-08-10 21:08 | 0 | |
![[SND]](/icons/sound2.gif) | bato bre.mp3 | 2022-08-10 20:55 | 1.2M | |
![[SND]](/icons/sound2.gif) | ss.mp3 | 2022-08-10 20:48 | 66K | |
![[SND]](/icons/sound2.gif) | oh-no-113125.mp3 | 2022-08-10 20:48 | 66K | |
![[SND]](/icons/sound2.gif) | me-hurt-sounds-40085.mp3 | 2022-08-10 20:46 | 401K | |
![[SND]](/icons/sound2.gif) | Drill1.mp3 | 2022-08-10 20:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | Underworld (Slowed + Bass Boosted)@KNRD Music Support Our Second Channel🙏🏻.mp3 | 2022-08-10 20:44 | 5.6M | |
![[SND]](/icons/sound2.gif) | Песня - По блоку катит Phantom мы как всегда на стиле.mp3 | 2022-08-10 20:39 | 5.7M | |
![[SND]](/icons/sound2.gif) | VIP3.mp3 | 2022-08-10 20:37 | 46M | |
![[SND]](/icons/sound2.gif) | VIP2.mp3 | 2022-08-10 20:37 | 25M | |
![[SND]](/icons/sound2.gif) | VIP1.mp3 | 2022-08-10 20:36 | 29M | |
![[SND]](/icons/sound2.gif) | suara pintu.mp3 | 2022-08-10 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Disguise.mp3 | 2022-08-10 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Azer.mp3 | 2022-08-10 20:28 | 0 | |
![[SND]](/icons/sound2.gif) | 11.mp3 | 2022-08-10 20:23 | 0 | |
![[SND]](/icons/sound2.gif) | srra16.mp3 | 2022-08-10 20:22 | 0 | |
![[SND]](/icons/sound2.gif) | thechille.mp3 | 2022-08-10 20:22 | 372K | |
![[SND]](/icons/sound2.gif) | december7.mp3 | 2022-08-10 20:17 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Fell Under a Spell Remix.mp3 | 2022-08-10 20:17 | 0 | |
![[SND]](/icons/sound2.gif) | Dhikaa9.mp3 | 2022-08-10 20:15 | 0 | |
![[SND]](/icons/sound2.gif) | _DIL_KI_DOYA_HOY_NA__by_Oyshee.mp3 | 2022-08-10 20:04 | 0 | |
![[SND]](/icons/sound2.gif) | yerle-yeksan-drill-remix.mp3 | 2022-08-10 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | Axepep7.mp3 | 2022-08-10 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | jor1.mp3 | 2022-08-10 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | memek1.mp3 | 2022-08-10 19:54 | 0 | |
![[SND]](/icons/sound2.gif) | Blood Upon the Risers -Gory Gory What a Hell of a Way to Die-.mp3 | 2022-08-10 19:52 | 0 | |
![[SND]](/icons/sound2.gif) | xcho_ty-i-ya.mp3 | 2022-08-10 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | TAWA.mp3 | 2022-08-10 19:50 | 0 | |
![[SND]](/icons/sound2.gif) | pure-n-a-cnv-sound-vol-14-file.mp3 | 2022-08-10 19:48 | 0 | |
![[SND]](/icons/sound2.gif) | ❄🍷Andreyka rmx🍷❄-🚫хуй с ним🚫-kissvk.com.mp3 | 2022-08-10 19:45 | 796K | |
![[SND]](/icons/sound2.gif) | on the floor.mp3 | 2022-08-10 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | AjiMat65.mp3 | 2022-08-10 19:45 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - MONSTER MASH.mp3 | 2022-08-10 19:41 | 0 | |
![[SND]](/icons/sound2.gif) | gromkaya_sirena_na_zvonok_telefona.mp3 | 2022-08-10 19:40 | 0 | |
![[SND]](/icons/sound2.gif) | Tabii.mp3 | 2022-08-10 19:38 | 0 | |
![[SND]](/icons/sound2.gif) | BalainDo5.mp3 | 2022-08-10 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | B5.mp3 | 2022-08-10 19:27 | 3.6M | |
![[SND]](/icons/sound2.gif) | vasco20.mp3 | 2022-08-10 19:25 | 0 | |
![[SND]](/icons/sound2.gif) | hatiku.mp3 | 2022-08-10 19:23 | 0 | |
![[SND]](/icons/sound2.gif) | Lucy2.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | Sgt3.MP.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | vektor-a-lyudi-mp3.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | Good1.mp3 | 2022-08-10 19:22 | 0 | |
![[SND]](/icons/sound2.gif) | PETRUNSKO_BY_FAN_ONE_BASS_BOOSTE_(getmp3.pro).mp3 | 2022-08-10 19:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lil_Morty_-_FLEXING_FINESSING.mp3 | 2022-08-10 19:15 | 0 | |
![[SND]](/icons/sound2.gif) | Вектор А-Люди-kissvk.com.mp3 | 2022-08-10 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | Get Get Down (Bass + Pitched down).mp3 | 2022-08-10 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | the new sweet groove.mp3 | 2022-08-10 19:01 | 0 | |
![[SND]](/icons/sound2.gif) | ozzy.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | John15.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | 1542027632_miyagi_-_rodnaya_poi_feat__kadi_muzonov_net.mp3 | 2022-08-10 18:57 | 0 | |
![[SND]](/icons/sound2.gif) | XXXTENTACION - Revenge (slowed & reverb)_.mp3 | 2022-08-10 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | faceit sound.mp3 | 2022-08-10 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | Nba YoungBoy - Chopper City.mp3 | 2022-08-10 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | NBA YoungBoy -No Switch (music video).mp3 | 2022-08-10 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | rb.mp3 | 2022-08-10 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | John125.mp3 | 2022-08-10 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | quiizzzmeow_-_Aomine_Daiki_(musmore.com).mp3 | 2022-08-10 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]Angel Baby - Troye Sivan.aZX2BoxbUdk.mp3 | 2022-08-10 18:45 | 2.0M | |
![[SND]](/icons/sound2.gif) | hhh.mp3 | 2022-08-10 18:43 | 0 | |
![[SND]](/icons/sound2.gif) | req.mp3 | 2022-08-10 18:41 | 0 | |
![[SND]](/icons/sound2.gif) | yanto02.mp3 | 2022-08-10 18:40 | 0 | |
![[SND]](/icons/sound2.gif) | yanto01.mp3 | 2022-08-10 18:39 | 0 | |
![[SND]](/icons/sound2.gif) | ধুলাবালি,_Dhulabali_by_Ashes_lyrics._Unofficial_video_song.mp3 | 2022-08-10 18:34 | 0 | |
![[SND]](/icons/sound2.gif) | Troye-Sivan-Angel-Baby-Lyrics_UsBOJRIAwZo.mp3 | 2022-08-10 18:33 | 192K | |
![[SND]](/icons/sound2.gif) | jen.mp3 | 2022-08-10 18:22 | 0 | |
![[SND]](/icons/sound2.gif) | TO KILL A GOD Epic Battle Dark Heroic Music Epic Music Mix by @Audiomachine.mp3 | 2022-08-10 18:16 | 0 | |
![[SND]](/icons/sound2.gif) | YNV.mp3 | 2022-08-10 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Мельница - Бес Джиги.mp3 | 2022-08-10 18:11 | 2.3M | |
![[SND]](/icons/sound2.gif) | zatyanu.mp3 | 2022-08-10 18:09 | 0 | |
![[SND]](/icons/sound2.gif) | 22.mp3 | 2022-08-10 18:06 | 1.0M | |
![[SND]](/icons/sound2.gif) | joby3.mp3 | 2022-08-10 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | joby1.mp3 | 2022-08-10 18:04 | 156K | |
![[SND]](/icons/sound2.gif) | joby2.mp3 | 2022-08-10 18:04 | 0 | |
![[SND]](/icons/sound2.gif) | verbee-odin-mp3-1.mp3 | 2022-08-10 17:56 | 0 | |
![[SND]](/icons/sound2.gif) | beograd-official-video.mp3 | 2022-08-10 17:55 | 0 | |
![[SND]](/icons/sound2.gif) | Masked Wolf - Pandemonium (Official Video).mp3 | 2022-08-10 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | videoplayback.mp3 | 2022-08-10 17:54 | 2.4M | |
![[SND]](/icons/sound2.gif) | BoyWithUke - Toxic.mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | Zatyany.mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | asitwas .mp3 | 2022-08-10 17:53 | 2.5M | |
![[SND]](/icons/sound2.gif) | Waterflame - Swirl! (Chip-tune Remix).mp3 | 2022-08-10 17:53 | 0 | |
![[SND]](/icons/sound2.gif) | Travis_Scott_-_SICKO_MODE_ft._Drake(256k).mp3 | 2022-08-10 17:52 | 0 | |
![[SND]](/icons/sound2.gif) | ♚💔🎲LADA PRIORA 2007🎲💔♚ - Затяну шнурки потуже подойди же что ты ну же.mp3 | 2022-08-10 17:52 | 0 | |
![[SND]](/icons/sound2.gif) | ck02.mp3 | 2022-08-10 17:50 | 0 | |
![[SND]](/icons/sound2.gif) | Rhove - Shakerando (prod. Voluptyk) (TestoLyrics) (mp3cut.net).mp3 | 2022-08-10 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | Shadowraze - showdown.mp3 | 2022-08-10 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | УННВ - Без даты (Remix) (Remix).mp3 | 2022-08-10 17:44 | 36K | |
![[SND]](/icons/sound2.gif) | Shadowraze - shadowfiend.mp3 | 2022-08-10 17:44 | 5.5M | |
![[SND]](/icons/sound2.gif) | Shadowraze - astral step.mp3 | 2022-08-10 17:44 | 4.6M | |
![[SND]](/icons/sound2.gif) | ba9a.mp3 | 2022-08-10 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | Christina_Perri_-_A_Thousand_Years_[Official_Music_Video](256k).mp3 | 2022-08-10 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | dgsdg.mp3 | 2022-08-10 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | 6feet.mp3 | 2022-08-10 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | atldance.mp3 | 2022-08-10 17:39 | 0 | |
![[SND]](/icons/sound2.gif) | scarlxrd6feet.mp3 | 2022-08-10 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | Fly Me to the Moon (Acoustic).mp3 | 2022-08-10 17:38 | 0 | |
![[SND]](/icons/sound2.gif) | rider11.mp3 | 2022-08-10 17:36 | 0 | |
![[SND]](/icons/sound2.gif) | Ba9a Ft Gharmoul - Mkarez (official music video)[Mpgun.com].mp3 | 2022-08-10 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | c.mp3 | 2022-08-10 17:34 | 136K | |
![[SND]](/icons/sound2.gif) | H8.HOOD - PHANTOM.mp3 | 2022-08-10 17:32 | 0 | |
![[SND]](/icons/sound2.gif) | Oxtan2.mp3 | 2022-08-10 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | sad1.mp3 | 2022-08-10 17:26 | 3.1M | |
![[SND]](/icons/sound2.gif) | YAd_Dobra_-_Vremya_molodjozhi_68701792.mp3 | 2022-08-10 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | sad2.mp3 | 2022-08-10 17:25 | 1.8M | |
![[SND]](/icons/sound2.gif) | m.mp3 | 2022-08-10 17:22 | 2.8M | |
![[SND]](/icons/sound2.gif) | pink1.mp3 | 2022-08-10 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Султан Лагучев - Любовь беда (Miro's Remix).mp3 | 2022-08-10 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | ck12.mp3 | 2022-08-10 17:18 | 0 | |
![[SND]](/icons/sound2.gif) | iwgd.mp3.mp3 | 2022-08-10 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | Hell March (Remastered).mp3 | 2022-08-10 17:16 | 0 | |
![[SND]](/icons/sound2.gif) | sad Dx.mp3 | 2022-08-10 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | abin.mp3 | 2022-08-10 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | Oxtan1.mp3 | 2022-08-10 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Arctic Monkeys Snap Out Of It Official Audio.mp3 | 2022-08-10 17:08 | 0 | |
![[SND]](/icons/sound2.gif) | ckrider1.mp3 | 2022-08-10 17:07 | 0 | |
![[SND]](/icons/sound2.gif) | s1.mp3 | 2022-08-10 17:07 | 340K | |
![[SND]](/icons/sound2.gif) | Gospozha_Kaguya_v_lyubvi_kak_na_vojne_-_2_sezon_Opening_(iPleer.com).mp3 | 2022-08-10 17:04 | 3.4M | |
![[SND]](/icons/sound2.gif) | BlueWednesday.mp3 | 2022-08-10 17:02 | 2.7M | |
![[SND]](/icons/sound2.gif) | Maprider1.mp3 | 2022-08-10 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | m.m4a | 2022-08-10 16:49 | 0 | |
![[SND]](/icons/sound2.gif) | maprideralle.mp3 | 2022-08-10 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | munni.mp3 | 2022-08-10 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | maprider.mp3 | 2022-08-10 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | perang.mp3 | 2022-08-10 16:46 | 1.2M | |
![[SND]](/icons/sound2.gif) | ms13.mp3 | 2022-08-10 16:46 | 2.0M | |
![[SND]](/icons/sound2.gif) | king.mp3 | 2022-08-10 16:46 | 3.0M | |
![[SND]](/icons/sound2.gif) | Wala.mp3.mp3 | 2022-08-10 16:45 | 0 | |
![[SND]](/icons/sound2.gif) | trim.09E25743-B1D4-4D53-ABE4-5B8CA3057D2E.mp3 | 2022-08-10 16:43 | 0 | |
![[SND]](/icons/sound2.gif) | Wala.mp3 | 2022-08-10 16:43 | 0 | |
![[SND]](/icons/sound2.gif) | zill100.mp3 | 2022-08-10 16:42 | 0 | |
![[SND]](/icons/sound2.gif) | chinwa probleme...عطوني..شيشة.. نطلع(MP3_320K).mp3 | 2022-08-10 16:37 | 3.4M | |
![[SND]](/icons/sound2.gif) | ck09.mp3 | 2022-08-10 16:32 | 11M | |
![[VID]](/icons/movie.gif) | Night.mp4 | 2022-08-10 16:32 | 12M | |
![[SND]](/icons/sound2.gif) | Maskoff.mp3 | 2022-08-10 16:29 | 1.7M | |
![[SND]](/icons/sound2.gif) | Chiddy-Bang-Old-Ways.mp3 | 2022-08-10 16:28 | 0 | |
![[SND]](/icons/sound2.gif) | Hang.mp3 | 2022-08-10 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | vaar.mp3 | 2022-08-10 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | Sancey.mp3 | 2022-08-10 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | zacky4.mp3 | 2022-08-10 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | purge.mp3 | 2022-08-10 16:02 | 0 | |
![[SND]](/icons/sound2.gif) | pp.mp3 | 2022-08-10 16:02 | 3.2M | |
![[SND]](/icons/sound2.gif) | S7.mp3 | 2022-08-10 15:56 | 2.4M | |
![[SND]](/icons/sound2.gif) | MALA - MORO FT PROFIT ZA3IM - STOOR - WEST ( VIDEO ANIMATION )(MP3_320K).mp3 | 2022-08-10 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | MT.mp3 | 2022-08-10 15:28 | 0 | |
![[SND]](/icons/sound2.gif) | Swagging13.mp3 | 2022-08-10 15:25 | 0 | |
![[SND]](/icons/sound2.gif) | Adfi.mp3 | 2022-08-10 15:23 | 0 | |
![[SND]](/icons/sound2.gif) | Misaki.mp3 | 2022-08-10 15:22 | 2.1M | |
![[SND]](/icons/sound2.gif) | Best.mp3 | 2022-08-10 15:20 | 0 | |
![[SND]](/icons/sound2.gif) | tnh.mp3 | 2022-08-10 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | kyh.mp3 | 2022-08-10 15:19 | 0 | |
![[SND]](/icons/sound2.gif) | dibui.mp3 | 2022-08-10 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | xipo.mp3 | 2022-08-10 15:18 | 0 | |
![[SND]](/icons/sound2.gif) | Thank you-ify jones.mp3 | 2022-08-10 15:15 | 0 | |
![[SND]](/icons/sound2.gif) | SADOP.mp3 | 2022-08-10 15:15 | 1.4M | |
![[SND]](/icons/sound2.gif) | siren.mp3 | 2022-08-10 15:15 | 6.9K | |
![[SND]](/icons/sound2.gif) | Charlie Pryce - Summer Sounds Vol 3.mp3 | 2022-08-10 15:11 | 0 | |
![[SND]](/icons/sound2.gif) | Minesr.mp3 | 2022-08-10 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | Ace Banzuelo - Muli (Lyrics).mp3 | 2022-08-10 15:09 | 4.4M | |
![[SND]](/icons/sound2.gif) | Bitch.mp3 | 2022-08-10 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | BooM1.mp3 | 2022-08-10 14:56 | 348K | |
![[SND]](/icons/sound2.gif) | bgmusic.mp3 | 2022-08-10 14:56 | 1.7M | |
![[SND]](/icons/sound2.gif) | vikramgirl.mp3 | 2022-08-10 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | DJSAD.mp3 | 2022-08-10 14:50 | 536K | |
![[SND]](/icons/sound2.gif) | Vp13.mp3 | 2022-08-10 14:49 | 2.3M | |
![[SND]](/icons/sound2.gif) | top.mp3 | 2022-08-10 14:48 | 3.1M | |
![[SND]](/icons/sound2.gif) | arcade.mp3 | 2022-08-10 14:47 | 3.9M | |
![[SND]](/icons/sound2.gif) | Maki.mp3 | 2022-08-10 14:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | sateboy.mp3 | 2022-08-10 14:09 | 0 | |
![[SND]](/icons/sound2.gif) | Кореш - глаза не врут.mp3 | 2022-08-10 14:08 | 0 | |
![[SND]](/icons/sound2.gif) | Eminem & 2Pac - Björn Ironside VS Ivar The Boneless (2019).mp3 | 2022-08-10 14:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - no copyright music Purple lofi background music_256kbps.mp3 | 2022-08-10 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | mmm.mp3 | 2022-08-10 14:04 | 2.2M | |
![[SND]](/icons/sound2.gif) | Thai3.mp3 | 2022-08-10 14:04 | 0 | |
![[SND]](/icons/sound2.gif) | Anees.mp3 | 2022-08-10 14:04 | 2.4M | |
![[SND]](/icons/sound2.gif) | Ayana2.mp3 | 2022-08-10 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Le rêve - Chococlub.mp3 | 2022-08-10 14:02 | 0 | |
![[SND]](/icons/sound2.gif) | Nm1.mp3 | 2022-08-10 14:02 | 2.6M | |
![[SND]](/icons/sound2.gif) | Hajib - Ezzin ( Medi Remix )(MP3_70K).mp3 | 2022-08-10 14:00 | 0 | |
![[SND]](/icons/sound2.gif) | orgenlampung.mp3 | 2022-08-10 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | HatdogManila.mp3 | 2022-08-10 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | wow.mp3 | 2022-08-10 13:55 | 2.1M | |
![[SND]](/icons/sound2.gif) | Vp21.mp3 | 2022-08-10 13:54 | 1.2M | |
![[SND]](/icons/sound2.gif) | Vp20.mp3 | 2022-08-10 13:54 | 2.5M | |
![[SND]](/icons/sound2.gif) | Vp19.mp3 | 2022-08-10 13:54 | 0 | |
![[SND]](/icons/sound2.gif) | Sateboy.mp3 | 2022-08-10 13:54 | 1.3M | |
![[SND]](/icons/sound2.gif) | Morshu_beatbox_loop_(getmp3.pro).mp3 | 2022-08-10 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | nhachay.mp3 | 2022-08-10 13:51 | 0 | |
![[SND]](/icons/sound2.gif) | relod.mp3 | 2022-08-10 13:49 | 256K | |
![[SND]](/icons/sound2.gif) | makna puasa.mp3 | 2022-08-10 13:49 | 0 | |
![[SND]](/icons/sound2.gif) | Bongga.mp3 | 2022-08-10 13:49 | 0 | |
![[SND]](/icons/sound2.gif) | RandaHalal.mp3 | 2022-08-10 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | Lagukuu.mp3 | 2022-08-10 13:45 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Unconditionally X Dandelions (Lyrics) Slowed Version (320kbps).mp3 | 2022-08-10 13:42 | 0 | |
![[SND]](/icons/sound2.gif) | Dancingqueen.mp3 | 2022-08-10 13:41 | 0 | |
![[SND]](/icons/sound2.gif) | Jamik_-_samoljotkarmv_rmx_(musportal.org).mp3 | 2022-08-10 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | På Topp Final.mp3 | 2022-08-10 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | Dacingqueen.mp3 | 2022-08-10 13:37 | 0 | |
![[SND]](/icons/sound2.gif) | VinKy11.mp3 | 2022-08-10 13:34 | 3.0M | |
![[SND]](/icons/sound2.gif) | RE.mp3 | 2022-08-10 13:31 | 2.9M | |
![[SND]](/icons/sound2.gif) | HD.mp3 | 2022-08-10 13:28 | 0 | |
![[SND]](/icons/sound2.gif) | awitin.mp3 | 2022-08-10 13:28 | 696K | |
![[SND]](/icons/sound2.gif) | AUD-20220605-WA0030.mp3 | 2022-08-10 13:26 | 617K | |
![[SND]](/icons/sound2.gif) | mp11.mp3 | 2022-08-10 13:26 | 3.3M | |
![[SND]](/icons/sound2.gif) | AUD-20220406-WA0026.mp3 | 2022-08-10 13:25 | 112K | |
![[SND]](/icons/sound2.gif) | lk.mp3 | 2022-08-10 13:24 | 199K | |
![[SND]](/icons/sound2.gif) | ASl.mp3 | 2022-08-10 13:24 | 0 | |
![[SND]](/icons/sound2.gif) | kl.mp3 | 2022-08-10 13:23 | 0 | |
![[SND]](/icons/sound2.gif) | huy1234.mp3 | 2022-08-10 13:21 | 0 | |
![[SND]](/icons/sound2.gif) | jh.mp3 | 2022-08-10 13:20 | 0 | |
![[SND]](/icons/sound2.gif) | Абрикоса - Влюбилась В Друга.mp3 | 2022-08-10 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | หูไม่ตรงกับตา (2).mp3 | 2022-08-10 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | DrawinCopyRight.mp3 | 2022-08-10 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | HJ.mp3 | 2022-08-10 13:15 | 3.4M | |
![[SND]](/icons/sound2.gif) | va7.mp3 | 2022-08-10 13:11 | 0 | |
![[SND]](/icons/sound2.gif) | hg3.mp3 | 2022-08-10 13:10 | 0 | |
![[SND]](/icons/sound2.gif) | AT40 01-23-1982 #1.mp3 | 2022-08-10 13:06 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK_2.mp3 | 2022-08-10 13:03 | 0 | |
![[SND]](/icons/sound2.gif) | Heart of Courage.mp3 | 2022-08-10 12:58 | 2.7M | |
![[SND]](/icons/sound2.gif) | freelofi.mp3 | 2022-08-10 12:54 | 0 | |
![[SND]](/icons/sound2.gif) | Joji - Glimpse Of Us.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan29.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan25.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan24.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan23.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan28.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ HANING SING PUSING MUKA KAYA KINGKONG.mp3 | 2022-08-10 12:53 | 0 | |
![[SND]](/icons/sound2.gif) | yan27.mp3 | 2022-08-10 12:52 | 0 | |
![[SND]](/icons/sound2.gif) | yan26.mp3 | 2022-08-10 12:52 | 0 | |
![[SND]](/icons/sound2.gif) | janji1.mp3 | 2022-08-10 12:49 | 632K | |
![[SND]](/icons/sound2.gif) | Fellixs3.mp3 | 2022-08-10 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Fellixs2.mp3 | 2022-08-10 12:48 | 0 | |
![[SND]](/icons/sound2.gif) | A7.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Untitled.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Fellixs1.mp3 | 2022-08-10 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | seto1.mp3 | 2022-08-10 12:43 | 0 | |
![[SND]](/icons/sound2.gif) | Diviners.mp3 | 2022-08-10 12:40 | 0 | |
![[SND]](/icons/sound2.gif) | A6.mp3 | 2022-08-10 12:36 | 2.8M | |
![[SND]](/icons/sound2.gif) | Vp18.mp3 | 2022-08-10 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | Vp17.mp3 | 2022-08-10 12:35 | 1.6M | |
![[SND]](/icons/sound2.gif) | Vp16.mp3 | 2022-08-10 12:35 | 3.0M | |
![[SND]](/icons/sound2.gif) | Vp15.mp3 | 2022-08-10 12:35 | 3.8M | |
![[SND]](/icons/sound2.gif) | Vp14.mp3 | 2022-08-10 12:35 | 3.2M | |
![[SND]](/icons/sound2.gif) | kzsquat.mp3 | 2022-08-10 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ DOMINO MAROKO TANGKIS DANG TIIKTOK VIRAL 2022.mp3 | 2022-08-10 12:34 | 0 | |
![[SND]](/icons/sound2.gif) | FSD.mp3 | 2022-08-10 12:33 | 852K | |
![[SND]](/icons/sound2.gif) | jo.mp3 | 2022-08-10 12:33 | 3.2M | |
![[SND]](/icons/sound2.gif) | Blights.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | jk.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | KontolX1.mp3 | 2022-08-10 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | MORI.mp3 | 2022-08-10 12:29 | 0 | |
![[SND]](/icons/sound2.gif) | Rahmat XxX1.mp3 | 2022-08-10 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | yt1s.com - living life in the night ringtonewhatsapp status PABLO BEATS.mp3 | 2022-08-10 12:28 | 0 | |
![[SND]](/icons/sound2.gif) | ModeM_-_V_rukakh_avtomat.mp3 | 2022-08-10 12:20 | 0 | |
![[SND]](/icons/sound2.gif) | haning.mp3 | 2022-08-10 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | lampung.mp3 | 2022-08-10 12:19 | 0 | |
![[SND]](/icons/sound2.gif) | basco sellout.mp3 | 2022-08-10 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | Anas4.mp3 | 2022-08-10 12:17 | 0 | |
![[SND]](/icons/sound2.gif) | Anas3.mp3 | 2022-08-10 12:16 | 0 | |
![[SND]](/icons/sound2.gif) | Marcus_-_Senorita_66243016.mp3 | 2022-08-10 12:12 | 0 | |
![[SND]](/icons/sound2.gif) | LeonskyXXX1.mp3 | 2022-08-10 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | Asw.mp3 | 2022-08-10 12:11 | 4.3M | |
![[SND]](/icons/sound2.gif) | Jancokk.mp3 | 2022-08-10 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | altjbreezeblocks.mp3 | 2022-08-10 12:09 | 0 | |
![[SND]](/icons/sound2.gif) | LeonskyXXX.mp3 | 2022-08-10 12:04 | 0 | |
![[SND]](/icons/sound2.gif) | joji.mp3 | 2022-08-10 12:04 | 2.7M | |
![[SND]](/icons/sound2.gif) | _Allen_GAMMATEP X LilAiNidd.mp3 | 2022-08-10 12:03 | 2.2M | |
![[SND]](/icons/sound2.gif) | lcrpbinibini.mp3 | 2022-08-10 12:00 | 144K | |
![[SND]](/icons/sound2.gif) | sedaya.mp3 | 2022-08-10 11:58 | 0 | |
![[SND]](/icons/sound2.gif) | yan9.mp3 | 2022-08-10 11:58 | 5.4M | |
![[SND]](/icons/sound2.gif) | yan6.mp3 | 2022-08-10 11:58 | 8.0M | |
![[SND]](/icons/sound2.gif) | yan8.mp3 | 2022-08-10 11:57 | 3.7M | |
![[SND]](/icons/sound2.gif) | yan7.mp3 | 2022-08-10 11:57 | 4.2M | |
![[SND]](/icons/sound2.gif) | yan3.mp3 | 2022-08-10 11:57 | 5.3M | |
![[SND]](/icons/sound2.gif) | Keep You Safe Yahya.mp3 | 2022-08-10 11:57 | 0 | |
![[SND]](/icons/sound2.gif) | yan5.mp3 | 2022-08-10 11:57 | 1.9M | |
![[SND]](/icons/sound2.gif) | yan4.mp3 | 2022-08-10 11:57 | 4.8M | |
![[SND]](/icons/sound2.gif) | yan21.mp3 | 2022-08-10 11:56 | 5.5M | |
![[SND]](/icons/sound2.gif) | yan22.mp3 | 2022-08-10 11:56 | 7.9M | |
![[SND]](/icons/sound2.gif) | yan20.mp3 | 2022-08-10 11:56 | 5.4M | |
![[SND]](/icons/sound2.gif) | yan2.mp3 | 2022-08-10 11:56 | 4.9M | |
![[SND]](/icons/sound2.gif) | yan13.mp3 | 2022-08-10 11:56 | 7.1M | |
![[SND]](/icons/sound2.gif) | yan19.mp3 | 2022-08-10 11:55 | 4.8M | |
![[SND]](/icons/sound2.gif) | yan15.mp3 | 2022-08-10 11:55 | 5.3M | |
![[SND]](/icons/sound2.gif) | yan18.mp3 | 2022-08-10 11:55 | 2.2M | |
![[SND]](/icons/sound2.gif) | yan16.mp3 | 2022-08-10 11:55 | 3.6M | |
![[SND]](/icons/sound2.gif) | yan14.mp3 | 2022-08-10 11:55 | 3.4M | |
![[SND]](/icons/sound2.gif) | yan17.mp3 | 2022-08-10 11:55 | 2.4M | |
![[SND]](/icons/sound2.gif) | yan12.mp3 | 2022-08-10 11:55 | 5.8M | |
![[SND]](/icons/sound2.gif) | yan01.mp3 | 2022-08-10 11:55 | 6.0M | |
![[SND]](/icons/sound2.gif) | yan11.mp3 | 2022-08-10 11:55 | 2.8M | |
![[SND]](/icons/sound2.gif) | yan10.mp3 | 2022-08-10 11:55 | 3.8M | |
![[SND]](/icons/sound2.gif) | yan1.mp3 | 2022-08-10 11:54 | 3.6M | |
![[SND]](/icons/sound2.gif) | yan000.mp3 | 2022-08-10 11:54 | 3.2M | |
![[SND]](/icons/sound2.gif) | yan00.mp3 | 2022-08-10 11:54 | 3.2M | |
![[SND]](/icons/sound2.gif) | yan0.mp3 | 2022-08-10 11:54 | 4.6M | |
![[SND]](/icons/sound2.gif) | Phonk7.mp3 | 2022-08-10 11:54 | 1.1M | |
![[SND]](/icons/sound2.gif) | toge0.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]DJ RINDU SEMALAM REMIX VIRAL TIKTOK TERBARU 2022 SEMALAM KU TAHAN KU TAHAN SEMALAM.HoPh8FM0h_E.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk6.mp3 | 2022-08-10 11:54 | 2.1M | |
![[SND]](/icons/sound2.gif) | Miyagi_JEndshpil_-_BadaBum_70693181.mp3 | 2022-08-10 11:54 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk9.mp3 | 2022-08-10 11:54 | 1.8M | |
![[SND]](/icons/sound2.gif) | lcrpmahika.mp3 | 2022-08-10 11:54 | 380K | |
![[SND]](/icons/sound2.gif) | Phonk8.mp3 | 2022-08-10 11:54 | 1.8M | |
![[SND]](/icons/sound2.gif) | Phonk5.mp3 | 2022-08-10 11:53 | 2.2M | |
![[SND]](/icons/sound2.gif) | Phonk4.mp3 | 2022-08-10 11:53 | 1.8M | |
![[SND]](/icons/sound2.gif) | Phonk3.mp3 | 2022-08-10 11:53 | 1.9M | |
![[SND]](/icons/sound2.gif) | Alt-J () _ Breezeblocks Lyrics (HQ).mp3 | 2022-08-10 11:53 | 0 | |
![[SND]](/icons/sound2.gif) | 𝕐𝒫𝒜人Ѣ𝓒𝓀𝖀𝕌-† - Блатная походка бандит 🍷-kissvk.com.mp3 | 2022-08-10 11:52 | 0 | |
![[SND]](/icons/sound2.gif) | rep.mp3 | 2022-08-10 11:50 | 0 | |
![[SND]](/icons/sound2.gif) | Phonk2.mp3 | 2022-08-10 11:49 | 2.0M | |
![[SND]](/icons/sound2.gif) | onlymp3.to - Alt-J (∆) _ Breezeblocks Lyrics (HQ)-kT6pFsVA6hA-192k-1660040896941.mp3 | 2022-08-10 11:48 | 652K | |
![[SND]](/icons/sound2.gif) | Phonk1.mp3 | 2022-08-10 11:47 | 1.3M | |
![[SND]](/icons/sound2.gif) | Uta1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO69.mp3 | 2022-08-10 11:47 | 11M | |
![[SND]](/icons/sound2.gif) | TOTTO61.mp3 | 2022-08-10 11:47 | 6.3M | |
![[SND]](/icons/sound2.gif) | TOTTO67.mp3 | 2022-08-10 11:47 | 4.8M | |
![[SND]](/icons/sound2.gif) | DUKH1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO68.mp3 | 2022-08-10 11:47 | 9.7M | |
![[SND]](/icons/sound2.gif) | TTA2.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | SAD2.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO70.mp3 | 2022-08-10 11:47 | 8.8M | |
![[SND]](/icons/sound2.gif) | TTA1.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | TOTTO72.mp3 | 2022-08-10 11:47 | 3.2M | |
![[SND]](/icons/sound2.gif) | TOTTO71.mp3 | 2022-08-10 11:47 | 3.3M | |
![[SND]](/icons/sound2.gif) | TOTTO80.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | VANIX.mp3 | 2022-08-10 11:47 | 0 | |
![[SND]](/icons/sound2.gif) | sw8.mp3 | 2022-08-10 11:46 | 0 | |
![[SND]](/icons/sound2.gif) | sw7.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | sw5.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | sw6.mp3 | 2022-08-10 11:45 | 0 | |
![[SND]](/icons/sound2.gif) | Mentahan ccp 30 detik lirik DJ Darkside by alan Walker.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | Ply2.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧c3.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | sw4.mp3 | 2022-08-10 11:44 | 0 | |
![[SND]](/icons/sound2.gif) | Harble-БЕН x Daycare Theme -FNAF Security Breach OST--kissvk.com.mp3 | 2022-08-10 11:43 | 0 | |
![[SND]](/icons/sound2.gif) | alok1.mp3 | 2022-08-10 11:42 | 213K | |
![[SND]](/icons/sound2.gif) | Playboi.mp3 | 2022-08-10 11:41 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧4𝙘𝙤.mp3 | 2022-08-10 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | 🥀💉Stetex💉🥀-🌪️niko and the niners🌪️-kissvk.com.mp3 | 2022-08-10 11:40 | 0 | |
![[SND]](/icons/sound2.gif) | —ʀ ᴀ s т ᴀ ғ ᴀ ʀ ɪ 🌴-Я знаю ты долеко - RMX --kissvk.com.mp3 | 2022-08-10 11:39 | 0 | |
![[SND]](/icons/sound2.gif) | 🔊💣😈Iliusha🔊💣😈-🌴𝕃𝔼𝕊𝕋𝔻𝕌𝕀𝕋🌴-kissvk.com.mp3 | 2022-08-10 11:38 | 0 | |
![[SND]](/icons/sound2.gif) | derevna.mp3 | 2022-08-10 11:37 | 0 | |
![[VID]](/icons/movie.gif) | f9336b6ba13bc84e1892b24f69375c5e.mp4 | 2022-08-10 11:37 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - DJ Dash Uciha Plis Ku Tak Suka Preman Slow Tik Tok Remix Terbaru 2021 (DJ Cantik Remix) (320 kbps).mp3 | 2022-08-10 11:37 | 0 | |
![[VID]](/icons/movie.gif) | Video-xin-vinh-biet-cu-www_tiengdong_com.mp4 | 2022-08-10 11:36 | 0 | |
![[SND]](/icons/sound2.gif) | bro hayuk mabar bro.mp3 | 2022-08-10 11:35 | 0 | |
![[SND]](/icons/sound2.gif) | smsa.mp3 | 2022-08-10 11:33 | 0 | |
![[SND]](/icons/sound2.gif) | 𝙙𝙧4𝙘𝙤 - 𝙛𝙧𝙖𝙢𝙚𝙙「 𝙨𝙥𝙚𝙙 𝙪𝙥 」.mp3 | 2022-08-10 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | herbaltea.mp3 | 2022-08-10 11:29 | 0 | |
![[SND]](/icons/sound2.gif) | 1657269509300_track.mp3 | 2022-08-10 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | Francesco Sartori & Sir James Galway - Time To Say Goodbye (megasongs.me).mp3 | 2022-08-10 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | vipusk.mp3.mp3 | 2022-08-10 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | snobbism.mp3 | 2022-08-10 11:24 | 0 | |
![[SND]](/icons/sound2.gif) | TikTok.mp3 | 2022-08-10 11:23 | 5.0M | |
![[SND]](/icons/sound2.gif) | konfuz-kajf-ty-pojmala-alexei-shkurko-remix-mp3.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | 25-meiko.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | LIZER_Moi_ruki_ne_krylya_da_i_lyudi_ne_pticy.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | alex-andreev-gip-y-prince-padal-belyj-sneg.mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | Ислам Итляшев - Ой ой ой сердце думай головой (mp3day.net).mp3 | 2022-08-10 11:20 | 0 | |
![[SND]](/icons/sound2.gif) | KIRYA_NASVAEV_-_MATIZ_nightcore_bassboost_74153549.mp3 | 2022-08-10 11:19 | 0 | |
![[SND]](/icons/sound2.gif) | Zx.mp3 | 2022-08-10 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | HerbalTea.mp3 | 2022-08-10 11:15 | 0 | |
![[SND]](/icons/sound2.gif) | _Salahkah kita_-robinhood ft asmirandah..mp3 | 2022-08-10 11:14 | 0 | |
![[SND]](/icons/sound2.gif) | paa.mp3.mp3 | 2022-08-10 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | Ariel.mp3 | 2022-08-10 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | Paa Sa Lupa Pilyo Gang Ft JCF.mp3 | 2022-08-10 11:10 | 0 | |
![[SND]](/icons/sound2.gif) | ཌ乂卂爪乇尺ད - 𝐒𝐍𝐎𝐖.mp3 | 2022-08-10 11:08 | 0 | |
![[VID]](/icons/movie.gif) | 5efada2250010dd06d5bfc8448fedfbc.mp4 | 2022-08-10 11:07 | 0 | |
![[SND]](/icons/sound2.gif) | GAYAZOV$ BROTHER$ - СИНИЙ ИНЕЙ.mp3 | 2022-08-10 11:04 | 0 | |
![[SND]](/icons/sound2.gif) | sktzxx.mp3 | 2022-08-10 11:03 | 0 | |
![[SND]](/icons/sound2.gif) | TUG.mp3 | 2022-08-10 11:00 | 0 | |
![[VID]](/icons/movie.gif) | 8e178bc25390c1107022f148bb786f2e.mp4 | 2022-08-10 10:59 | 0 | |
![[SND]](/icons/sound2.gif) | lkdj.mp3 | 2022-08-10 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | Üsma.m4a | 2022-08-10 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | MATRANG - ПАТРИАРХАТ (1).mp3 | 2022-08-10 10:48 | 848K | |
![[SND]](/icons/sound2.gif) | Vip4.mp3 | 2022-08-10 10:48 | 3.8M | |
![[SND]](/icons/sound2.gif) | ilham10.mp3 | 2022-08-10 10:47 | 2.8M | |
![[SND]](/icons/sound2.gif) | Masteran 1 jam untuk murai batu isian lengkap.mp3 | 2022-08-10 10:45 | 0 | |
![[SND]](/icons/sound2.gif) | ลลา นกบนหลาดง White-rumped shama Display.mp3 | 2022-08-10 10:44 | 452K | |
![[SND]](/icons/sound2.gif) | BUDOTS.mp3 | 2022-08-10 10:44 | 15M | |
![[SND]](/icons/sound2.gif) | Suara pikat burung sertu 100 ampuh!!! Dan memancing sertu yg macet bunyi.mp3 | 2022-08-10 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | Masteran Favorit Murai Batu Suara Burung 3 In 1. Tengkek Buto, Cililin, Kapas Tembak.mp3 | 2022-08-10 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | sw3.mp3 | 2022-08-10 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Baby Shark - Good Habits and Many More Videos Popular Nursery Rhymes Collection.mp3 | 2022-08-10 10:43 | 0 | |
![[SND]](/icons/sound2.gif) | Ne2.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Suara burung cipohsirtu cocok buat mancing jantan.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Johny Johny Yes Papa Ball Pit Show - ChuChu TV 3D Baby Songs & Nursery Rhymes for Kids.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | sw2.mp3 | 2022-08-10 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Baby goes to Old MacDonalds Farm + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | 10AGE_-_Malyshka_74140548.mp3 | 2022-08-10 10:41 | 0 | |
![[SND]](/icons/sound2.gif) | Baby's Humpty Dumpty Song + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Andery_Toronto_Diman_Bryukhanov_-_Karavan_73442350.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Pat a Cake + Many more Nursery Rhymes & Kids Songs - ChuChu TV LIVE.mp3 | 2022-08-10 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Happy Kid's Cartoon Music Background.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Funny Kids Children's Music (Instrumental Music For Kids).mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Cute Background Music for Videos - Cute Little Tikes Kids Song by Happy Face Music.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Classics - Let's Learn The Colors! Nursery Rhymes and Kids Songs.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Bath Song 2 + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | ChuChu TV Classics - Head Shoulders Knees & Toes Dance Song Nursery Rhymes and Kids Songs.mp3 | 2022-08-10 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | Soft Relaxing Baby Sleep Music Best Bedtime Lullabies For Toddlers Good Night Sweet Dreams.mp3 | 2022-08-10 10:38 | 0 | |
![[SND]](/icons/sound2.gif) | Lullabies For Kids - Sleep Baby Nursery Rhymes and Kids Songs Baby Songs Little Baby Bum.mp3 | 2022-08-10 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | k5Ax.mp3 | 2022-08-10 10:37 | 1.1M | |
![[SND]](/icons/sound2.gif) | DJ-Sikok-Bagi-Duo-Tik-Tok-Remix-Terbaru-2022-DJ-Cantik-Remix_a3cS7dQCKGI.mp3 | 2022-08-10 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | Bath Song 2 - ChuChu TV Nursery Rhymes & Kids Songs.mp3 | 2022-08-10 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | Siti Nurhaliza - Aisyah Istri Rasulullah ( Cover ).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | SABYAN - AISYAH ISTRI RASULULLAHCOVER.mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH - ANISA RAHMAN (Cover).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | Aisyah Istri Rasulullah (cover by Sheryl Shazwanie).mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH - PUTIH ABU ABU COVER.mp3 | 2022-08-10 10:35 | 0 | |
![[SND]](/icons/sound2.gif) | AISYAH ISTRI RASULULLAH COVER BY BABY SHIMA.mp3 | 2022-08-10 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | Aisyah Istri Rasulullah versi Upin Ipin Terbaru 2020.mp3 | 2022-08-10 10:34 | 0 | |
![[SND]](/icons/sound2.gif) | ash.mp3 | 2022-08-10 10:33 | 3.3M | |
![[SND]](/icons/sound2.gif) | Ne3.mp3 | 2022-08-10 10:32 | 0 | |
![[VID]](/icons/movie.gif) | Vp7.mp4 | 2022-08-10 10:21 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Drift (Fast & Furious).mp3 | 2022-08-10 10:16 | 564K | |
![[SND]](/icons/sound2.gif) | Dajj.mp3 | 2022-08-10 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | dejj.mp3 | 2022-08-10 10:14 | 0 | |
![[SND]](/icons/sound2.gif) | Manifest.mp3 | 2022-08-10 10:12 | 3.4M | |
![[SND]](/icons/sound2.gif) | Mr. Bill Collector.m4a | 2022-08-10 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | luckydj.mp3 | 2022-08-10 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN, The Limba, NILETTO, Boombl4 - СКОЛЬКО СТОИТ ЛЮБОВЬ.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | NIGHTMORSS - SECRET.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN - Домой.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Surf Curse - Freaks (Slowed Down).mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Kordhell - Scopin.mp3 | 2022-08-10 10:05 | 3.9M | |
![[SND]](/icons/sound2.gif) | ЯМАУГЛИ - ТАРАНТИНО.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Cyrus312 - Horny nigga detected.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Kaito Shoma - konfuz x kaito.mp3 | 2022-08-10 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Maulana-Ardiansyah-Dermaga-Biru-Live-Ska-Reggae_Og6_0laepzM.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | DERMAGA-BIRU-Thomas-Arya-Cover-Sasa-Official_eXPdhMDKHFY.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Dermaga-Biru-Thomas-Arya-cover-Literasi-60-Detik-by-AA-Kacif_Va1F0ydiHoI.mp3 | 2022-08-10 10:03 | 0 | |
![[SND]](/icons/sound2.gif) | Vikram - Rolex BGM.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Get Out Of My Way - KGF 2 ! Remix.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Chirakukal-Mulakkuvan(PagalWorld).mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | chekuthan_kalame_poyidam.mp3 | 2022-08-10 10:00 | 0 | |
![[SND]](/icons/sound2.gif) | Kaadhal-En-Kaviye-MassTamilan.dev.mp3 | 2022-08-10 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Suzume no Tojimari.mp3 | 2022-08-10 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | rafy-glaza-mp3 (1).mp3 | 2022-08-10 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | ENZO MF - BANDO feat. Nateman (Official Music Video).mp3 | 2022-08-10 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | gsuqkxj.mp3 | 2022-08-10 09:54 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - បទថ្មីកំពុងល្បីក្នុង Tik tok 🎬🎼 New Songs by Chan Studio 🎬🎶🎞️ (128 kbps).mp3 | 2022-08-10 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | carlruploadmusic1.mp3 | 2022-08-10 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Thundercat - 'Tron Song'-XYGEEa4Qcis-160k-1660125036692.mp3 | 2022-08-10 09:50 | 0 | |
![[SND]](/icons/sound2.gif) | get.mp3 | 2022-08-10 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | loveann.mp3 | 2022-08-10 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | WSHL.mp3 | 2022-08-10 09:44 | 0 | |
![[SND]](/icons/sound2.gif) | DCM.mp3 | 2022-08-10 09:43 | 0 | |
![[SND]](/icons/sound2.gif) | HAPPY.mp3 | 2022-08-10 09:42 | 3.0M | |
![[SND]](/icons/sound2.gif) | Макс Корж - Малиновый закат.mp3 | 2022-08-10 09:42 | 0 | |
![[SND]](/icons/sound2.gif) | DSAAC.mp3 | 2022-08-10 09:40 | 0 | |
![[SND]](/icons/sound2.gif) | Slava_-_YA_i_ty_52551041.mp3 | 2022-08-10 09:36 | 0 | |
![[SND]](/icons/sound2.gif) | SION Rework Voce Italiana -SION Rework Voice ITA 2014 (mp3cut.net).m4a | 2022-08-10 09:36 | 0 | |
![[SND]](/icons/sound2.gif) | mp50.mp3 | 2022-08-10 09:34 | 0 | |
![[SND]](/icons/sound2.gif) | ken.mp3 | 2022-08-10 09:34 | 0 | |
![[SND]](/icons/sound2.gif) | Troye.m4a | 2022-08-10 09:31 | 0 | |
![[SND]](/icons/sound2.gif) | SUPIAR OTO - D'ROC'K (Official Music Video) (1).mp3 | 2022-08-10 09:29 | 0 | |
![[SND]](/icons/sound2.gif) | seboy.mp3 | 2022-08-10 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | TUT.mp3 | 2022-08-10 09:26 | 0 | |
![[SND]](/icons/sound2.gif) | KAS.mp3 | 2022-08-10 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | anime.mp3 | 2022-08-10 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | ASK.mp3 | 2022-08-10 09:25 | 2.9M | |
![[SND]](/icons/sound2.gif) | REMIX1.mp3 | 2022-08-10 09:25 | 3.2M | |
![[SND]](/icons/sound2.gif) | Geometry Dash - SLAUGHTERHOUSE_(MP3Ball.ru).mp3 | 2022-08-10 09:23 | 0 | |
![[SND]](/icons/sound2.gif) | MORGENSHTERN, Элджей - Cadillac.mp3 | 2022-08-10 09:23 | 6.8M | |
![[SND]](/icons/sound2.gif) | Molchat_Doma_-_Na_dne_58595703.mp3 | 2022-08-10 09:22 | 0 | |
![[SND]](/icons/sound2.gif) | Mil.mp3 | 2022-08-10 09:20 | 0 | |
![[SND]](/icons/sound2.gif) | inginusai.mp3 | 2022-08-10 09:19 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-feat-eldzhey-cadillac.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | dgt12.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | Bakit.mp3 | 2022-08-10 09:15 | 0 | |
![[SND]](/icons/sound2.gif) | какашка pou - игры для всей семьи (1).mp3 | 2022-08-10 09:14 | 0 | |
![[SND]](/icons/sound2.gif) | zm1.mp3 | 2022-08-10 09:12 | 44K | |
![[SND]](/icons/sound2.gif) | 11678.mp3 | 2022-08-10 09:09 | 0 | |
![[SND]](/icons/sound2.gif) | Bugoy.mp3 | 2022-08-10 09:07 | 2.7M | |
![[SND]](/icons/sound2.gif) | jakone_-_kurit__(feat._a.v.g__itachi)_muzati.net.mp3 | 2022-08-10 09:06 | 0 | |
![[SND]](/icons/sound2.gif) | NOBITA - IKAW LANG _ Official Lyric Video.mp3 | 2022-08-10 08:53 | 4.0M | |
![[SND]](/icons/sound2.gif) | Because - Marlboro Black.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Al James - Pahinga (Official Audio).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Pagsamo - Arthur Nery (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Al James - Pa-umaga.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | December Avenue - Huling Sandali (OFFICIAL LYRIC VIDEO).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Munimuni - Bawat Piyesa (Official Lyric Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Adie - Paraluman (Official Audio).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | 727 Clique - Family Day.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Joji - Sanctuary (Official Video).mp3 | 2022-08-10 08:53 | 2.9M | |
![[SND]](/icons/sound2.gif) | Joji - SLOW DANCING IN THE DARK.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Munimuni - Sa Hindi Pag-alala (Lyric Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | PARASITIKO - Jrldm ft. Lexus (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Akala Mo Ata (OMV) - Nateman x Realest Cram x CK YG (Dir. by Lua Swish).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Akala Mo Ata (feat. Nateman, Realest Cram & CK YG).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Paraluman sad version.mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | UNIQUE - Sino (Official Music Video).mp3 | 2022-08-10 08:53 | 0 | |
![[SND]](/icons/sound2.gif) | Fenn7.mp3 | 2022-08-10 08:52 | 0 | |
![[SND]](/icons/sound2.gif) | lambi-judai.mp3 | 2022-08-10 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | kewer1.mp3 | 2022-08-10 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | zara-sa.mp3 | 2022-08-10 08:40 | 0 | |
![[SND]](/icons/sound2.gif) | AA.mp3 | 2022-08-10 08:38 | 80K | |
![[SND]](/icons/sound2.gif) | Rex Orange County - THE SHADE (Official Audio).mp3 | 2022-08-10 08:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fenn9Athecraz1.mp3 | 2022-08-10 08:31 | 2.8M | |
![[SND]](/icons/sound2.gif) | djj1.mp3 | 2022-08-10 08:17 | 3.3M | |
![[SND]](/icons/sound2.gif) | Zhu Ni Shengri Kuai Le- Happy Birthday Mandarin Chinese Kid Song Lyrics.mp3 | 2022-08-10 08:17 | 0 | |
![[SND]](/icons/sound2.gif) | dj4.mp3 | 2022-08-10 08:16 | 480K | |
![[SND]](/icons/sound2.gif) | A.L.A - Piano (feat. Didine Canon 16).mp3 | 2022-08-10 08:08 | 0 | |
![[SND]](/icons/sound2.gif) | NAAN JACKSON.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made3.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made2.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | Made1.mp3 | 2022-08-10 08:07 | 0 | |
![[SND]](/icons/sound2.gif) | OPPANA SONG,.mp3 | 2022-08-10 08:04 | 0 | |
![[SND]](/icons/sound2.gif) | POORAM KANAN DJ.mp3 | 2022-08-10 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - VIET DEEP 2022 - HOUSE LAK CHILL ĐI BẠN ƠI, VIỆT MIX 2022 - SET NHẠC CHILL (128 kbps).mp3 | 2022-08-10 08:02 | 44K | |
![[SND]](/icons/sound2.gif) | Fennfenn1.mp3 | 2022-08-10 08:02 | 0 | |
![[SND]](/icons/sound2.gif) | FennFenn1.mp3 | 2022-08-10 08:00 | 0 | |
![[SND]](/icons/sound2.gif) | Seafret - Atlantis (Lyrics).mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | sulthan.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | SHA.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | Ezra6.mp3 | 2022-08-10 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | Los.mp3 | 2022-08-10 07:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ed Sheeran - Photograph (Official Music Video).mp3 | 2022-08-10 07:57 | 0 | |
![[SND]](/icons/sound2.gif) | sulthan 1.mp3 | 2022-08-10 07:56 | 0 | |
![[SND]](/icons/sound2.gif) | Vel.mp3 | 2022-08-10 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | Nicky Youre, dazy - Sunroof (Official Music Video).mp3 | 2022-08-10 07:52 | 2.7M | |
![[SND]](/icons/sound2.gif) | a505.mp3 | 2022-08-10 07:47 | 0 | |
![[SND]](/icons/sound2.gif) | SARJANA.mp3 | 2022-08-10 07:39 | 0 | |
![[SND]](/icons/sound2.gif) | ligaw.mp3 | 2022-08-10 07:39 | 104K | |
![[SND]](/icons/sound2.gif) | DjFenn1.mp3 | 2022-08-10 07:39 | 1.1M | |
![[SND]](/icons/sound2.gif) | DjFenn2.mp3 | 2022-08-10 07:38 | 3.0M | |
![[SND]](/icons/sound2.gif) | hohey.mp3 | 2022-08-10 07:29 | 140K | |
![[SND]](/icons/sound2.gif) | glassanimals.mp3 | 2022-08-10 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | djthailand.mp3 | 2022-08-10 07:29 | 0 | |
![[SND]](/icons/sound2.gif) | middle of night.mp3 | 2022-08-10 07:29 | 2.8M | |
![[SND]](/icons/sound2.gif) | man.mp3 | 2022-08-10 07:28 | 4.2M | |
![[SND]](/icons/sound2.gif) | Bentot.mp3 | 2022-08-10 07:27 | 0 | |
![[SND]](/icons/sound2.gif) | ZX.mp3 | 2022-08-10 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | badcurt-kert-ya-tebya-lyublyu-mp3.mp3 | 2022-08-10 07:26 | 0 | |
![[SND]](/icons/sound2.gif) | typeluv-poslan.mp3 | 2022-08-10 07:24 | 0 | |
![[SND]](/icons/sound2.gif) | Marikit.mp3 | 2022-08-10 07:00 | 0 | |
![[SND]](/icons/sound2.gif) | Baak_Gmlcineliolu_-_Bir_Anda_73825968.mp3 | 2022-08-10 06:49 | 0 | |
![[SND]](/icons/sound2.gif) | blls3.mp3 | 2022-08-10 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | :)).mp3 | 2022-08-10 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | Troye.mp3 | 2022-08-10 06:29 | 3.1M | |
![[SND]](/icons/sound2.gif) | Xcho_Mr_Lambo_-_Zakryla_dal_74291179.mp3 | 2022-08-10 06:27 | 0 | |
![[SND]](/icons/sound2.gif) | tonggiavy.mp3 | 2022-08-10 06:27 | 0 | |
![[SND]](/icons/sound2.gif) | MOLLBEN37.mp3 | 2022-08-10 06:16 | 2.8M | |
![[SND]](/icons/sound2.gif) | itoangliga.mp3 | 2022-08-10 06:11 | 3.2M | |
![[SND]](/icons/sound2.gif) | euphoria.mp3 | 2022-08-10 06:10 | 0 | |
![[SND]](/icons/sound2.gif) | Demeter_Discoteka.mp3 | 2022-08-10 06:02 | 0 | |
![[SND]](/icons/sound2.gif) | RAIKAHO - Психопат.mp3 | 2022-08-10 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | HTRCP1.mp3 | 2022-08-10 06:00 | 0 | |
![[SND]](/icons/sound2.gif) | dhhje.mp3 | 2022-08-10 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | Instrumen Sedih, Instrumen Musik paling Sedih, Instrumen Sedih Bikin Nangis.mp3 | 2022-08-10 05:59 | 0 | |
![[SND]](/icons/sound2.gif) | bsata.mp3 | 2022-08-10 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | pasaway.mp3 | 2022-08-10 05:57 | 0 | |
![[SND]](/icons/sound2.gif) | PSYCHEDELIC BOYZ - RAWSTARR TIL I DIE (BATANG PASAWAY)_160k.mp3 | 2022-08-10 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Rawr8.mp3 | 2022-08-10 05:55 | 0 | |
![[SND]](/icons/sound2.gif) | Tekiteki.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | mabagal.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | munimuni.mp3 | 2022-08-10 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | Lily of The Valley.mp3 | 2022-08-10 05:53 | 328K | |
![[SND]](/icons/sound2.gif) | papel.mp3 | 2022-08-10 05:53 | 5.8M | |
![[SND]](/icons/sound2.gif) | xinmaruocdau.mp3 | 2022-08-10 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | kadhal.mp3 | 2022-08-10 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | Kannil.mp3 | 2022-08-10 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | Rabbane.mp3 | 2022-08-10 05:51 | 0 | |
![[SND]](/icons/sound2.gif) | Lilyofthevalley.m4a | 2022-08-10 05:49 | 0 | |
![[SND]](/icons/sound2.gif) | ghbd.mp3 | 2022-08-10 05:41 | 2.9M | |
![[SND]](/icons/sound2.gif) | bg.mp3 | 2022-08-10 05:39 | 8.2M | |
![[SND]](/icons/sound2.gif) | AleksMarty_Corrosive.mp3 | 2022-08-10 05:38 | 2.2M | |
![[SND]](/icons/sound2.gif) | Za.mp3 | 2022-08-10 05:38 | 4.0M | |
![[SND]](/icons/sound2.gif) | botsurpdj12.mp3 | 2022-08-10 05:38 | 0 | |
![[SND]](/icons/sound2.gif) | FERDZ X ELLA EYS X PACHO - SUNDO (COSA NOSTRA I OST).mp3 | 2022-08-10 05:37 | 0 | |
![[SND]](/icons/sound2.gif) | Tetap Dalam Jiwa.mp3 | 2022-08-10 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | WENAKK.mp3 | 2022-08-10 05:30 | 0 | |
![[SND]](/icons/sound2.gif) | Audioghh.mp3 | 2022-08-10 05:27 | 0 | |
![[SND]](/icons/sound2.gif) | ferdzapelyido.mp3 | 2022-08-10 05:22 | 0 | |
![[SND]](/icons/sound2.gif) | requestferdz.mp3 | 2022-08-10 05:21 | 0 | |
![[SND]](/icons/sound2.gif) | mr7.mp3 | 2022-08-10 05:20 | 3.3M | |
![[SND]](/icons/sound2.gif) | gk tau.mp3 | 2022-08-10 05:20 | 0 | |
![[SND]](/icons/sound2.gif) | za.mp3 | 2022-08-10 05:19 | 0 | |
![[SND]](/icons/sound2.gif) | fmhdlg.mp3 | 2022-08-10 05:19 | 3.2M | |
![[SND]](/icons/sound2.gif) | DJ ENAKEUNN V4 X MAMA BALE BALE VINKY YT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI !.mp3 | 2022-08-10 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | mr5.mp3 | 2022-08-10 05:16 | 3.2M | |
![[SND]](/icons/sound2.gif) | frdz.mp3 | 2022-08-10 05:14 | 756K | |
![[SND]](/icons/sound2.gif) | mr4.mp3 | 2022-08-10 05:12 | 3.1M | |
![[SND]](/icons/sound2.gif) | mr3.mp3 | 2022-08-10 05:07 | 2.8M | |
![[SND]](/icons/sound2.gif) | mr2.mp3 | 2022-08-10 05:02 | 2.7M | |
![[SND]](/icons/sound2.gif) | joby101.mp3 | 2022-08-10 04:56 | 892K | |
![[SND]](/icons/sound2.gif) | Jeydii.mp3 | 2022-08-10 04:55 | 752K | |
![[SND]](/icons/sound2.gif) | mr1.mp3 | 2022-08-10 04:54 | 4.6M | |
![[SND]](/icons/sound2.gif) | ulap.mp3 | 2022-08-10 04:52 | 0 | |
![[SND]](/icons/sound2.gif) | yellow.mp3 | 2022-08-10 04:52 | 3.2M | |
![[SND]](/icons/sound2.gif) | bmw.mp3 | 2022-08-10 04:51 | 0 | |
![[SND]](/icons/sound2.gif) | pano.mp3 | 2022-08-10 04:51 | 3.9M | |
![[SND]](/icons/sound2.gif) | sanctuary.mp3 | 2022-08-10 04:50 | 2.8M | |
![[SND]](/icons/sound2.gif) | somebody.mp3 | 2022-08-10 04:50 | 2.2M | |
![[SND]](/icons/sound2.gif) | pasko.mp3 | 2022-08-10 04:43 | 0 | |
![[SND]](/icons/sound2.gif) | Bahanapui.mp3 | 2022-08-10 04:40 | 0 | |
![[SND]](/icons/sound2.gif) | sjdajd.mp3.mp3 | 2022-08-10 04:38 | 0 | |
![[SND]](/icons/sound2.gif) | Cf.mp3 | 2022-08-10 04:32 | 0 | |
![[SND]](/icons/sound2.gif) | SAO.mp3 | 2022-08-10 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | Seinpogi.mp3 | 2022-08-10 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | Wanna.mp3 | 2022-08-10 04:21 | 3.1M | |
![[SND]](/icons/sound2.gif) | y2mate.com - The Walters I Love You So_320kbps.mp3 | 2022-08-10 04:18 | 0 | |
![[SND]](/icons/sound2.gif) | Callip12.mp3 | 2022-08-10 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | music2.mp3 | 2022-08-10 04:08 | 108K | |
![[SND]](/icons/sound2.gif) | GASAGA.mp3 | 2022-08-10 04:07 | 348K | |
![[SND]](/icons/sound2.gif) | Suzume-no-Tojimari-Trailer-2-SONG-Suzume-Nanoka-Hara-Lyrics-KAN-ROM-ENG_RO2mt82300Q.mp3 | 2022-08-10 03:59 | 0 | |
![[SND]](/icons/sound2.gif) | music1.mp3 | 2022-08-10 03:57 | 3.8M | |
![[SND]](/icons/sound2.gif) | Kiyo x Because - Ano na [Slow remix] PROD. SHORTONE.mp3 | 2022-08-10 03:55 | 0 | |
![[SND]](/icons/sound2.gif) | Shanti Dope - Nadarang (Official Music Video).mp3 | 2022-08-10 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Lo ki - Munting Paraiso (Lyrics).mp3 | 2022-08-10 03:50 | 0 | |
![[SND]](/icons/sound2.gif) | Lo Ki - Kagome (Official Music Video).mp3 | 2022-08-10 03:50 | 3.7M | |
![[SND]](/icons/sound2.gif) | VAR.mp3 | 2022-08-10 03:49 | 0 | |
![[SND]](/icons/sound2.gif) | Dre Dog - Smoke Dope and Rap.mp3 | 2022-08-10 03:46 | 0 | |
![[SND]](/icons/sound2.gif) | TEN1.mp3 | 2022-08-10 03:38 | 0 | |
![[SND]](/icons/sound2.gif) | bla.mp3 | 2022-08-10 03:36 | 0 | |
![[SND]](/icons/sound2.gif) | pln.mp3 | 2022-08-10 03:32 | 1.6M | |
![[SND]](/icons/sound2.gif) | IMG_1243.MOV.mp3 | 2022-08-10 03:27 | 0 | |
![[SND]](/icons/sound2.gif) | Hiling.mp3 | 2022-08-10 03:22 | 4.5M | |
![[SND]](/icons/sound2.gif) | AUD-20220605-WA0046.mp3 | 2022-08-10 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220314-WA0050.m4a | 2022-08-10 03:20 | 0 | |
![[SND]](/icons/sound2.gif) | АСТМА 3..mp3 | 2022-08-10 03:18 | 0 | |
![[SND]](/icons/sound2.gif) | Line.mp3 | 2022-08-10 03:15 | 3.8M | |
![[SND]](/icons/sound2.gif) | Lambi Judai 128 Kbps.mp3 | 2022-08-10 03:15 | 0 | |
![[SND]](/icons/sound2.gif) | Zara Sa.mp3 | 2022-08-10 03:11 | 0 | |
![[SND]](/icons/sound2.gif) | JhoNT2.mp3 | 2022-08-10 03:04 | 0 | |
![[VID]](/icons/movie.gif) | Better Call Saul - Chuck loses control.mp4 | 2022-08-10 03:01 | 0 | |
![[SND]](/icons/sound2.gif) | Cheriimoya_feat._Sierra_Kidd_feat._55_-_living_life_in_the_night_(Gybka.com).mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | TAKBO.mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | Zachem_mne_solnce_v_Monako_polnaya_versiya_-_Pesnya_73364115.mp3 | 2022-08-10 02:51 | 0 | |
![[SND]](/icons/sound2.gif) | LoOk aT aLL tHoSe ElVeS.mp3 | 2022-08-10 02:47 | 0 | |
![[SND]](/icons/sound2.gif) | Lil_Nas_X_-_Panini_Official_Video.mp3 | 2022-08-10 02:40 | 0 | |
![[SND]](/icons/sound2.gif) | Man Screaming CEEDAY Sound Effect HD.mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | CaWa - Balenciaga (www.hotplayer.ru).mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Mick Gordon The Only Thing They Fear Is You DOOM Eternal OST High Quality 2020.mp3 | 2022-08-10 02:38 | 0 | |
![[SND]](/icons/sound2.gif) | Home_With_Hope.mp3 | 2022-08-10 02:36 | 0 | |
![[SND]](/icons/sound2.gif) | The Only Thing They Fear Is You ( DOOM Eternal OST High Quality 2021 MICK GORDON).mp3 | 2022-08-10 02:34 | 0 | |
![[SND]](/icons/sound2.gif) | dj8.mp3 | 2022-08-10 02:30 | 504K | |
![[SND]](/icons/sound2.gif) | 8mb.video-n8U-RPTnuLjT.mp3 | 2022-08-10 02:30 | 0 | |
![[SND]](/icons/sound2.gif) | RTX.mp3 | 2022-08-10 02:27 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-09 at 3.22.21 PM.mp3 | 2022-08-10 02:26 | 0 | |
![[SND]](/icons/sound2.gif) | TLT.mp3 | 2022-08-10 02:25 | 0 | |
![[SND]](/icons/sound2.gif) | behind_the_chimney_DEMO_29-5-22_2-1.mp3 | 2022-08-10 02:23 | 0 | |
![[SND]](/icons/sound2.gif) | WhatsApp Audio 2022-08-10 at 09.17.47.mp3 | 2022-08-10 02:19 | 0 | |
![[SND]](/icons/sound2.gif) | CHOP.mp3 | 2022-08-10 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | ajpanalo.mp3 | 2022-08-10 02:17 | 0 | |
![[SND]](/icons/sound2.gif) | dj7.mp3 | 2022-08-10 02:15 | 504K | |
![[SND]](/icons/sound2.gif) | dj5.mp3 | 2022-08-10 02:15 | 424K | |
![[SND]](/icons/sound2.gif) | DAK.mp3 | 2022-08-10 02:15 | 4.2M | |
![[SND]](/icons/sound2.gif) | Aisyah.mp3 | 2022-08-10 02:13 | 3.6M | |
![[SND]](/icons/sound2.gif) | intropanalo.mp3 | 2022-08-10 02:13 | 0 | |
![[SND]](/icons/sound2.gif) | Turu.mp3 | 2022-08-10 02:12 | 732K | |
![[SND]](/icons/sound2.gif) | Jopay.mp3 | 2022-08-10 02:11 | 4.1M | |
![[SND]](/icons/sound2.gif) | Hmmm.mp3 | 2022-08-10 01:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sadboy.mp3 | 2022-08-10 01:41 | 1.1M | |
![[SND]](/icons/sound2.gif) | ecan.mp3 | 2022-08-10 01:38 | 0 | |
![[SND]](/icons/sound2.gif) | thangcam.mp3 | 2022-08-10 01:33 | 0 | |
![[SND]](/icons/sound2.gif) | Staring at Stars.mp3 | 2022-08-10 01:33 | 0 | |
![[VID]](/icons/movie.gif) | Tastelike Cake - Starring at stars ( Dream Piano Song ).mp4 | 2022-08-10 01:30 | 0 | |
![[SND]](/icons/sound2.gif) | Rn17.mp3 | 2022-08-10 01:27 | 0 | |
![[SND]](/icons/sound2.gif) | inbound833631831458767416.mp3 | 2022-08-10 01:26 | 0 | |
![[SND]](/icons/sound2.gif) | poyuya.mp3 | 2022-08-10 01:23 | 0 | |
![[SND]](/icons/sound2.gif) | ngoisaocodon.mp3 | 2022-08-10 01:21 | 0 | |
![[SND]](/icons/sound2.gif) | mp2.mp3 | 2022-08-10 01:20 | 3.0M | |
![[SND]](/icons/sound2.gif) | bensound-buddy.mp3 | 2022-08-10 01:17 | 0 | |
![[SND]](/icons/sound2.gif) | Musik.mp3 | 2022-08-10 01:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - ささえる人の歌 back number.mp3 | 2022-08-10 01:14 | 0 | |
![[SND]](/icons/sound2.gif) | unwell.mp3 | 2022-08-10 01:13 | 0 | |
![[SND]](/icons/sound2.gif) | 1575866702_korol_i_shut_vospominaniya_o_byloy_lyubvi.mp3 | 2022-08-10 01:11 | 0 | |
![[SND]](/icons/sound2.gif) | SAFESAFE.mp3 | 2022-08-10 01:06 | 0 | |
![[SND]](/icons/sound2.gif) | Central Cee Doja Directed by Cole Bennett_2.mp3 | 2022-08-10 01:05 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Drift - Teriyaki Boyz [ MUSIC VIDEO ] HD.mp3 | 2022-08-10 01:03 | 3.9M | |
![[SND]](/icons/sound2.gif) | Daun Jatuh - Resah Jadi Luka (Official Audio).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | seandainya - vierra (slowed reverb lyrics).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | LAST CHILD - BERNAFAS TANPAMU (Lirik Lyric).mp3 | 2022-08-10 01:03 | 0 | |
![[SND]](/icons/sound2.gif) | Covidv.mp3 | 2022-08-10 01:02 | 0 | |
![[SND]](/icons/sound2.gif) | covidvibes.mp3 | 2022-08-10 01:00 | 0 | |
![[SND]](/icons/sound2.gif) | hey_loser_you_scared_yes.mp3 | 2022-08-10 00:49 | 0 | |
![[VID]](/icons/movie.gif) | VID_20220810015523.mp4 | 2022-08-10 00:41 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Story Wa Anime AOT Lagu Sasageyo.mp3 | 2022-08-10 00:24 | 0 | |
![[SND]](/icons/sound2.gif) | Vyacheslav Mescherin Orchestra - Frogs.mp3 | 2022-08-10 00:13 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220804-WA0000.mp3 | 2022-08-09 23:57 | 0 | |
![[SND]](/icons/sound2.gif) | Al_Bakara.mp3 | 2022-08-09 23:55 | 0 | |
![[SND]](/icons/sound2.gif) | Sura_2_Al-Bakara_Korova_-_Korana_na_arabskom_s_perevodom_na_russkij_yazyk._(iPleer.com).mp3 | 2022-08-09 23:51 | 0 | |
![[SND]](/icons/sound2.gif) | Fireboy_DML_ft_Asake_-_Bandana_AstroBaze.com.mp3 | 2022-08-09 23:32 | 0 | |
![[SND]](/icons/sound2.gif) | Fireboy_DML_-_Change_AstroBaze.com.mp3 | 2022-08-09 23:30 | 0 | |
![[SND]](/icons/sound2.gif) | vp11.mp3 | 2022-08-09 23:28 | 0 | |
![[SND]](/icons/sound2.gif) | kanjut.mp3 | 2022-08-09 23:25 | 0 | |
![[VID]](/icons/movie.gif) | Vp1.mp4 | 2022-08-09 23:13 | 0 | |
![[SND]](/icons/sound2.gif) | Y2Mate.is - Indila - Tourner Dans Le Vide-vtNJMAyeP0s-160k-1660086324721.mp3 | 2022-08-09 23:06 | 0 | |
![[SND]](/icons/sound2.gif) | vs3.mp3 | 2022-08-09 22:55 | 0 | |
![[SND]](/icons/sound2.gif) | vs2.mp3 | 2022-08-09 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | vs1.mp3 | 2022-08-09 22:54 | 0 | |
![[SND]](/icons/sound2.gif) | Юлия_Савичева_Не_смотри_PHONK_EDITION_BY_KINEZIS.mp3 | 2022-08-09 22:53 | 1.2M | |
![[SND]](/icons/sound2.gif) | one direction - strong.mp3 | 2022-08-09 22:42 | 0 | |
![[SND]](/icons/sound2.gif) | قراءة منظومة الزمزمي_ _للقارئ علي صلاح عمر_ مركز تكوين المفسر.mp3 | 2022-08-09 22:29 | 0 | |
![[VID]](/icons/movie.gif) | carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_smnQolF2.mp4 | 2022-08-09 22:19 | 0 | |
![[SND]](/icons/sound2.gif) | tian1.mp3 | 2022-08-09 22:12 | 0 | |
![[SND]](/icons/sound2.gif) | teste.mp3 | 2022-08-09 22:12 | 44K | |
![[SND]](/icons/sound2.gif) | Sc3.mp3 | 2022-08-09 22:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | Derya Uluğ - Kanunlar Gibi (Mert Kurt Remix).mp3 | 2022-08-09 22:05 | 0 | |
![[VID]](/icons/movie.gif) | carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_MwoYl7Yg.mp4 | 2022-08-09 22:03 | 0 | |
![[SND]](/icons/sound2.gif) | toro1.mp3 | 2022-08-09 21:55 | 4.1M | |
![[SND]](/icons/sound2.gif) | OVERTIME ROUGH DRAFT (working on).mp3 | 2022-08-09 21:53 | 4.7M | |
![[SND]](/icons/sound2.gif) | Rainy Day yes vocals first mix (online-audio-converter.com)(2).mp3 | 2022-08-09 21:50 | 0 | |
![[SND]](/icons/sound2.gif) | Neck_Deep_-_December(128k).mp3 | 2022-08-09 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | logingnlrp.mp3 | 2022-08-09 21:48 | 0 | |
![[SND]](/icons/sound2.gif) | IShowSpeed - Shake (Official Music Video).mp3 | 2022-08-09 21:44 | 0 | |
![[SND]](/icons/sound2.gif) | one-shot-a-la-conquete_456239046.mp3 | 2022-08-09 21:44 | 0 | |
![[SND]](/icons/sound2.gif) | loginlrp.m4a | 2022-08-09 21:42 | 420K | |
![[SND]](/icons/sound2.gif) | Adur.mp3 | 2022-08-09 21:42 | 2.2M | |
![[SND]](/icons/sound2.gif) | Grey.mp3 | 2022-08-09 21:39 | 2.9M | |
![[SND]](/icons/sound2.gif) | Самурай.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-now.com - Eminem Dr Dre 50 Cent Crack A Bottle Official Video.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | CALLX_9-8-2022_21-49-21_01096076324.mp3 | 2022-08-09 21:25 | 0 | |
![[SND]](/icons/sound2.gif) | INSTASAMKA_-_moneyken-love.mp3 | 2022-08-09 21:18 | 0 | |
![[SND]](/icons/sound2.gif) | Scally_Milano_163ONMYNECK_-_Swag_73511571.mp3 | 2022-08-09 21:16 | 0 | |
![[SND]](/icons/sound2.gif) | wshr1.mp3 | 2022-08-09 21:05 | 0 | |
![[SND]](/icons/sound2.gif) | ER3.mp3 | 2022-08-09 21:04 | 0 | |
![[SND]](/icons/sound2.gif) | ER2.mp3 | 2022-08-09 21:03 | 0 | |
![[SND]](/icons/sound2.gif) | Myusl_-_Kurwa_Bobr_74481210.mp3 | 2022-08-09 20:55 | 0 | |
![[SND]](/icons/sound2.gif) | oo.mp3 | 2022-08-09 20:51 | 1.7M | |
![[SND]](/icons/sound2.gif) | BB8.mp3 | 2022-08-09 20:51 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Arctic Monkeys - Do I Wanna Know_ (Official Video) (320kbps).mp3 | 2022-08-09 20:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sting_money_Audio_425507.mp3 | 2022-08-09 20:35 | 0 | |
![[SND]](/icons/sound2.gif) | Batu2.mp3 | 2022-08-09 20:32 | 0 | |
![[SND]](/icons/sound2.gif) | Batu1.mp3 | 2022-08-09 20:32 | 8.0M | |
![[SND]](/icons/sound2.gif) | ii.mp3 | 2022-08-09 20:22 | 4.5M | |
![[SND]](/icons/sound2.gif) | MyBandaMiyagi.mp3 | 2022-08-09 20:11 | 3.7M | |
![[SND]](/icons/sound2.gif) | SANTUY.mp3 | 2022-08-09 20:10 | 2.7M | |
![[SND]](/icons/sound2.gif) | Selamat Pagi Dunia Tipu Tipu.mp3 | 2022-08-09 20:09 | 0 | |
![[SND]](/icons/sound2.gif) | DeadList1.mp3 | 2022-08-09 20:08 | 0 | |
![[SND]](/icons/sound2.gif) | DvLidhouse.mp3 | 2022-08-09 20:06 | 0 | |
![[SND]](/icons/sound2.gif) | DJ GO SAMPE BAWAH OMO KUCRUT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp3 | 2022-08-09 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | NangDumatingKa.mp3 | 2022-08-09 20:03 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi_My_Banda_[www.UZmir.net].mp3 | 2022-08-09 20:01 | 0 | |
![[SND]](/icons/sound2.gif) | DDTrack.mp3 | 2022-08-09 19:58 | 0 | |
![[SND]](/icons/sound2.gif) | Nang Dumating Ka - Bandang Lapis (Official Lyric Video).mp3 | 2022-08-09 19:57 | 0 | |
![[SND]](/icons/sound2.gif) | MiyaGi & Эндшпиль & МанТана - Моя Банда [www.UZmir.net].mp3 | 2022-08-09 19:55 | 0 | |
![[SND]](/icons/sound2.gif) | ENIGMA - CAMRY 3.5 (slow remix) (www.hotplayer.ru).mp3 | 2022-08-09 19:51 | 0 | |
![[SND]](/icons/sound2.gif) | NDMK.mp3 | 2022-08-09 19:47 | 0 | |
![[SND]](/icons/sound2.gif) | mimpi.mp3 | 2022-08-09 19:43 | 2.6M | |
![[SND]](/icons/sound2.gif) | lagimuah.mp3 | 2022-08-09 19:42 | 0 | |
![[SND]](/icons/sound2.gif) | Чистое Небо - Гитара 16 (1).mp3 | 2022-08-09 19:35 | 0 | |
![[SND]](/icons/sound2.gif) | Павел Пламенев - Эй мёртвый! Проснись! (акустика).mp3 | 2022-08-09 19:33 | 0 | |
![[SND]](/icons/sound2.gif) | Wonder.mp3 | 2022-08-09 19:29 | 0 | |
![[SND]](/icons/sound2.gif) | Miracle.mp3 | 2022-08-09 19:25 | 0 | |
![[SND]](/icons/sound2.gif) | Crazier.mp3 | 2022-08-09 19:20 | 284K | |
![[SND]](/icons/sound2.gif) | Cutie.mp3 | 2022-08-09 19:15 | 2.6M | |
![[SND]](/icons/sound2.gif) | Ako.mp3 | 2022-08-09 19:13 | 0 | |
![[SND]](/icons/sound2.gif) | sforek.mp3 | 2022-08-09 19:11 | 0 | |
![[SND]](/icons/sound2.gif) | sax.mp3 | 2022-08-09 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | tulok.mp3 | 2022-08-09 19:08 | 0 | |
![[SND]](/icons/sound2.gif) | Might.mp3 | 2022-08-09 19:07 | 0 | |
![[SND]](/icons/sound2.gif) | CHABAH2 (درجة الصوت -0.05 - سرعة إيقاع 103).mp3 | 2022-08-09 19:06 | 0 | |
![[SND]](/icons/sound2.gif) | mrv01.mp3 | 2022-08-09 19:05 | 0 | |
![[SND]](/icons/sound2.gif) | gimn-sssr-rossii-instrumentalnaya-zapis.mp3 | 2022-08-09 19:04 | 4.7M | |
![[SND]](/icons/sound2.gif) | CHABAH2.mp3 | 2022-08-09 19:03 | 0 | |
![[SND]](/icons/sound2.gif) | mrv.mp3 | 2022-08-09 19:00 | 0 | |
![[SND]](/icons/sound2.gif) | TIOO.mp3 | 2022-08-09 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | Tioosj.mp3 | 2022-08-09 18:56 | 0 | |
![[SND]](/icons/sound2.gif) | ning1.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning2.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning3.mp3 | 2022-08-09 18:52 | 0 | |
![[SND]](/icons/sound2.gif) | ning5.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | ning4.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1657432160661.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | Dj Bbhc Pyramid.mp3 | 2022-08-09 18:51 | 0 | |
![[SND]](/icons/sound2.gif) | rz1.mp3 | 2022-08-09 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps) (1).mp3 | 2022-08-09 18:50 | 0 | |
![[SND]](/icons/sound2.gif) | SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps).mp3 | 2022-08-09 18:49 | 0 | |
![[SND]](/icons/sound2.gif) | JElektroforez_-_505_Legko_sojjti_s_uma_72662961.mp3 | 2022-08-09 18:48 | 0 | |
![[SND]](/icons/sound2.gif) | fenicks.mp3 | 2022-08-09 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | Bones - Timberlake (ft. Juicy J).mp3 | 2022-08-09 18:47 | 0 | |
![[SND]](/icons/sound2.gif) | FelixVander.mp3 | 2022-08-09 18:44 | 5.9M | |
![[SND]](/icons/sound2.gif) | grave!.mp3 | 2022-08-09 18:39 | 3.3M | |
![[SND]](/icons/sound2.gif) | Koy.mp3 | 2022-08-09 18:37 | 8.9M | |
![[SND]](/icons/sound2.gif) | N4.mp3 | 2022-08-09 18:33 | 0 | |
![[SND]](/icons/sound2.gif) | Record (online-voice-recorder.com).mp3 | 2022-08-09 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | Not Around - Nova.mp3 | 2022-08-09 18:30 | 0 | |
![[SND]](/icons/sound2.gif) | touch.mp3 | 2022-08-09 18:28 | 3.5M | |
![[SND]](/icons/sound2.gif) | 1515401487_gazirovka-black-www_muzonov_net.mp3 | 2022-08-09 18:28 | 0 | |
![[SND]](/icons/sound2.gif) | hamd.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | dqsng.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | hehe.mp3 | 2022-08-09 18:27 | 0 | |
![[SND]](/icons/sound2.gif) | 1096.mp3 | 2022-08-09 18:25 | 0 | |
![[SND]](/icons/sound2.gif) | ᴘᴏ_ᴋᴀɪꜰᴜ_🍷_кайфуша'_🤤✌🏿_Мастер_И_Маргарита(1).mp3 | 2022-08-09 18:24 | 0 | |
![[SND]](/icons/sound2.gif) | walwal.mp3 | 2022-08-09 18:24 | 6.3M | |
![[SND]](/icons/sound2.gif) | Sohigh.mp3 | 2022-08-09 18:24 | 0 | |
![[SND]](/icons/sound2.gif) | KRK FtNA Official MV Prod By Sakarin.mp3 | 2022-08-09 18:20 | 0 | |
![[SND]](/icons/sound2.gif) | So High.mp3 | 2022-08-09 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | Bruno Mars, Anderson .Paak, Silk Sonic - Smokin Out The Window.mp3 | 2022-08-09 18:17 | 0 | |
![[SND]](/icons/sound2.gif) | zhalan-dunie-zhalan-eken.mp3 | 2022-08-09 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | Suzume.mp3 | 2022-08-09 18:15 | 0 | |
![[SND]](/icons/sound2.gif) | Сектор Газа - ЛИРИКА PHONK EDITION PROD NERONUS (mp3-2020.com).mp3 | 2022-08-09 18:14 | 0 | |
![[SND]](/icons/sound2.gif) | jackmafia100.mp3 | 2022-08-09 18:13 | 0 | |
![[SND]](/icons/sound2.gif) | Press2pNick - John Muir.mp3 | 2022-08-09 18:13 | 0 | |
![[SND]](/icons/sound2.gif) | djhie1.mp3 | 2022-08-09 18:12 | 0 | |
![[SND]](/icons/sound2.gif) | Tulus - Monokrom - sped up.mp3 | 2022-08-09 18:12 | 0 | |
![[SND]](/icons/sound2.gif) | zhalan-dunie-zhalan-eken_(muzzona.kz).mp3 | 2022-08-09 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Malaak_Op.mp3 | 2022-08-09 18:11 | 0 | |
![[SND]](/icons/sound2.gif) | Mlk_1.mp3 | 2022-08-09 18:10 | 448K | |
![[SND]](/icons/sound2.gif) | DJ CLOSE YOUR EYES X GAM GAM TEKI TEKI VIRAL TIKTOK‼️DJ TIKTOK REMIX VIRAL 2022‼️.mp3 | 2022-08-09 18:05 | 4.0M | |
![[SND]](/icons/sound2.gif) | Тима Белорусских - Знаток.mp3 | 2022-08-09 18:05 | 7.1M | |
![[SND]](/icons/sound2.gif) | FelixGans.mp3 | 2022-08-09 18:04 | 31M | |
![[SND]](/icons/sound2.gif) | Sc2.mp3 | 2022-08-09 18:04 | 3.6M | |
![[SND]](/icons/sound2.gif) | Sc1.mp3 | 2022-08-09 18:04 | 3.2M | |
![[SND]](/icons/sound2.gif) | Hujan.mp3 | 2022-08-09 18:04 | 1.7M | |
![[SND]](/icons/sound2.gif) | dora-doradura-mp3 (1).mp3 | 2022-08-09 17:57 | 0 | |
![[SND]](/icons/sound2.gif) | MAHIKA.mp3 | 2022-08-09 17:55 | 3.1M | |
![[SND]](/icons/sound2.gif) | modern-talking-cheri-cheri-lady.mp3 | 2022-08-09 17:54 | 0 | |
![[SND]](/icons/sound2.gif) | helmandj7.mp3 | 2022-08-09 17:53 | 3.3M | |
![[SND]](/icons/sound2.gif) | ЧЁРНЫЕ ГЛАЗА - (phonk edition) (mp3day.net).mp3 | 2022-08-09 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | helmandj8.mp3 | 2022-08-09 17:51 | 0 | |
![[SND]](/icons/sound2.gif) | Seinsong.mp3 | 2022-08-09 17:49 | 0 | |
![[SND]](/icons/sound2.gif) | 10467-irina-kairatovna-shiza-kok-tu.mp3 | 2022-08-09 17:48 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.app - PtrpStudio - ชอบเธออะ (Prod by. Sakarin) (128 kbps).mp3 | 2022-08-09 17:46 | 0 | |
![[SND]](/icons/sound2.gif) | Sein1.mp3 | 2022-08-09 17:44 | 556K | |
![[SND]](/icons/sound2.gif) | sad45.mp3 | 2022-08-09 17:44 | 0 | |
![[SND]](/icons/sound2.gif) | zawsze.mp3 | 2022-08-09 17:43 | 0 | |
![[SND]](/icons/sound2.gif) | X2Download.com - UN Owen Was Her - Nico Nico Douga ~ Ronald McDonald (128 kbps).mp3 | 2022-08-09 17:42 | 0 | |
![[SND]](/icons/sound2.gif) | fabdoua.mp3 | 2022-08-09 17:40 | 0 | |
![[SND]](/icons/sound2.gif) | alltype.mp3 | 2022-08-09 17:37 | 0 | |
![[SND]](/icons/sound2.gif) | St1.mp3 | 2022-08-09 17:35 | 3.4M | |
![[SND]](/icons/sound2.gif) | SnapTik_7124337818679201050.mp3 | 2022-08-09 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | savannah.mp3 | 2022-08-09 17:35 | 0 | |
![[SND]](/icons/sound2.gif) | Tulusinteraksi3.mp3 | 2022-08-09 17:34 | 0 | |
![[SND]](/icons/sound2.gif) | Tulusjuni2.mp3 | 2022-08-09 17:33 | 0 | |
![[SND]](/icons/sound2.gif) | icalsad.mp3 | 2022-08-09 17:33 | 0 | |
![[SND]](/icons/sound2.gif) | Pesanterakhir1.mp3 | 2022-08-09 17:33 | 0 | |
![[VID]](/icons/movie.gif) | SnapTik_7126513311683743003.mp4 | 2022-08-09 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | Until I Found You 💛Newest Arthur Miguel Non Stop Playlist 2022💛Bagong OPM Ibig Kanta 2022.mp3 | 2022-08-09 17:30 | 0 | |
![[SND]](/icons/sound2.gif) | TINDER ROLEPLAY - PROD BY MANGBORIS (Official Audio).mp3 | 2022-08-09 17:29 | 0 | |
![[SND]](/icons/sound2.gif) | #AJIMAT⚡ - MY GANG! (Official Music Video).mp3 | 2022-08-09 17:27 | 0 | |
![[SND]](/icons/sound2.gif) | sein.mp3 | 2022-08-09 17:26 | 0 | |
![[SND]](/icons/sound2.gif) | strumble.mp3 | 2022-08-09 17:25 | 0 | |
![[SND]](/icons/sound2.gif) | Dito.mp3 | 2022-08-09 17:25 | 3.5M | |
![[SND]](/icons/sound2.gif) | sikok bagi duo.mp3 | 2022-08-09 17:21 | 0 | |
![[SND]](/icons/sound2.gif) | Vendetta - Этот Дым - Miro Pircxalava.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Скриптонит - Пацан [Chill Vibe Version by ERWI] - Constant Music.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Иду Как И Шел - INFINITY MUSIC.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Веселей - Скриптонит.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | ендшпиль-гости уйдут - legenda_13.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Train Wreck - kizaru.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | Metro Pro - Valiko - Nextgen.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 50 сеnt & Каспийский груз disco inferno - ☠️𝕯𝖊𝖆𝖉𝖑𝛄 𝖒𝖚𝖘𝖎𝖈☠️.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | H8.HOOD - PHANTOM (official music) - 1agares1.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 01. Делюгу - Макухин.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | First Day Out - kizaru.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | DAIS - Glock - DAIS.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | 03. Его Крышуют Мусара - Макухин.mp3 | 2022-08-09 17:20 | 0 | |
![[SND]](/icons/sound2.gif) | •Как мне жаль ваши души• - Mara$ladkiy.mp3 | 2022-08-09 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | TRT.mp3 | 2022-08-09 17:19 | 0 | |
![[SND]](/icons/sound2.gif) | 2008.mp3 | 2022-08-09 17:18 | 2.1M | |
![[SND]](/icons/sound2.gif) | tom1.mp3 | 2022-08-09 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | HUM.mp3 | 2022-08-09 17:17 | 0 | |
![[SND]](/icons/sound2.gif) | chien.mp3 | 2022-08-09 17:15 | 0 | |
![[SND]](/icons/sound2.gif) | odel.mp3 | 2022-08-09 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | yeu.mp3 | 2022-08-09 17:14 | 0 | |
![[SND]](/icons/sound2.gif) | TST.mp3 | 2022-08-09 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | showw.mp3 | 2022-08-09 17:13 | 0 | |
![[SND]](/icons/sound2.gif) | We asked Richard how he integrates rhetoric and phonetic delivery in his training and what is the unique methodology behind it (1).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is gamification company culture (3).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is balancing his time as a leader (2).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | despacito.mp3 | 2022-08-09 17:12 | 4.3M | |
![[SND]](/icons/sound2.gif) | During COVID-19, Costa Rica's Call Center's CEO, Richard Blank managed to keep having successful interactions, happy customers and engaged employees (1).mp3 | 2022-08-09 17:12 | 0 | |
![[SND]](/icons/sound2.gif) | The Art and Science of Call Center Success, with Richard Blank from Costa Rica's Call Center - Cutter Consulting Group.mp3 | 2022-08-09 17:11 | 0 | |
![[SND]](/icons/sound2.gif) | aboba.mp3 | 2022-08-09 17:10 | 0 | |
![[SND]](/icons/sound2.gif) | DJ Chechen - Чеченская лезгинка.mp3 | 2022-08-09 17:08 | 772K | |
![[SND]](/icons/sound2.gif) | alo.mp3 | 2022-08-09 17:08 | 4.3M | |
![[SND]](/icons/sound2.gif) | arcannistrp.mp3 | 2022-08-09 17:06 | 0 | |
![[SND]](/icons/sound2.gif) | arc.mp3 | 2022-08-09 17:06 | 0 | |
![[SND]](/icons/sound2.gif) | saep1.mp3 | 2022-08-09 17:03 | 0 | |
![[SND]](/icons/sound2.gif) | Dan.mp3 | 2022-08-09 17:02 | 2.4M | |
![[SND]](/icons/sound2.gif) | ngoisao.mp3 | 2022-08-09 16:57 | 0 | |
![[SND]](/icons/sound2.gif) | vf.mp3 | 2022-08-09 16:56 | 0 | |
![[SND]](/icons/sound2.gif) | sando.mp3 | 2022-08-09 16:53 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com_-_GTARPNETWORK_Heading.mp3 | 2022-08-09 16:52 | 0 | |
![[SND]](/icons/sound2.gif) | itsyouu.mp3 | 2022-08-09 16:48 | 0 | |
![[SND]](/icons/sound2.gif) | Diz3.mp3 | 2022-08-09 16:47 | 0 | |
![[SND]](/icons/sound2.gif) | wannamarry.mp3 | 2022-08-09 16:46 | 0 | |
![[SND]](/icons/sound2.gif) | Defamilita.mp3 | 2022-08-09 16:41 | 0 | |
![[SND]](/icons/sound2.gif) | Tadhana.mp3 | 2022-08-09 16:37 | 1.0M | |
![[SND]](/icons/sound2.gif) | ligaya.mp3 | 2022-08-09 16:34 | 444K | |
![[SND]](/icons/sound2.gif) | Katha.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Ito.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | mhine.mp3 | 2022-08-09 16:33 | 0 | |
![[SND]](/icons/sound2.gif) | Ligaya.mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | behh.mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | Tokyo Ghoul - Opening (original).mp3 | 2022-08-09 16:32 | 0 | |
![[SND]](/icons/sound2.gif) | 6IX9INE - POLICE ft. 50 Cent (RapKing Music Video)(MP3_320K).mp3 | 2022-08-09 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Mehro - perfume (Lyrics) (320kbps).mp3 | 2022-08-09 16:31 | 0 | |
![[SND]](/icons/sound2.gif) | kane + ketceh 😎☝.mp3 | 2022-08-09 16:27 | 0 | |
![[SND]](/icons/sound2.gif) | m49.mp3 | 2022-08-09 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | lot.mp3 | 2022-08-09 16:26 | 0 | |
![[SND]](/icons/sound2.gif) | kash.mp3.mp3 | 2022-08-09 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | youu.mp3 | 2022-08-09 16:25 | 0 | |
![[SND]](/icons/sound2.gif) | FiiyOzawa.mp3 | 2022-08-09 16:22 | 0 | |
![[SND]](/icons/sound2.gif) | DanMachi Season 4 Opening FullTentouby Sajou no Hana.mp3 | 2022-08-09 16:21 | 0 | |
![[SND]](/icons/sound2.gif) | Liga.mp3 | 2022-08-09 16:21 | 0 | |
![[SND]](/icons/sound2.gif) | Mine.mp3 | 2022-08-09 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | BASS.mp3 | 2022-08-09 16:20 | 0 | |
![[SND]](/icons/sound2.gif) | inbound6601697356567906970.mp3 | 2022-08-09 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | Metan_-_SHnurki_73239954.mp3 | 2022-08-09 16:16 | 0 | |
![[SND]](/icons/sound2.gif) | BASS1.mp3 | 2022-08-09 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ JEDAG JEDUG FULL BASS Lagu tik tok viral 2021 WilfexBor Terbaru (1).mp3 | 2022-08-09 16:15 | 0 | |
![[SND]](/icons/sound2.gif) | inbound7796932345223699318.mp3 | 2022-08-09 16:14 | 0 | |
![[SND]](/icons/sound2.gif) | ajh.mp3 | 2022-08-09 16:08 | 0 | |
![[SND]](/icons/sound2.gif) | musica-the-descent-kevin-macleod.mp3 | 2022-08-09 16:07 | 0 | |
![[SND]](/icons/sound2.gif) | wax1.mp3 | 2022-08-09 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | trac.mp3 | 2022-08-09 16:05 | 0 | |
![[SND]](/icons/sound2.gif) | zlij_reper_zenik_-_gmo_(z2.fm).mp3 | 2022-08-09 15:58 | 0 | |
![[SND]](/icons/sound2.gif) | TP1.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Sound1.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa12.mp3 | 2022-08-09 15:48 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa11.mp3 | 2022-08-09 15:47 | 0 | |
![[SND]](/icons/sound2.gif) | Zxa10.mp3 | 2022-08-09 15:47 | 0 | |
![[SND]](/icons/sound2.gif) | lil-tecca-ransom-directed-by-cole-bennett-ytmp3juice.mp3 | 2022-08-09 15:45 | 0 | |
![[SND]](/icons/sound2.gif) | tiktok-i-just-can-t‼️-kevin-rater-remix-2021-ytmp3juice.mp3 | 2022-08-09 15:45 | 0 | |
![[SND]](/icons/sound2.gif) | mzlff-Нерпы все в адидасах (Original Version) [Peanzo Remix].mp3 | 2022-08-09 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | DJBLDABTCH.mp3 | 2022-08-09 15:43 | 0 | |
![[SND]](/icons/sound2.gif) | LZ1.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ3.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ2.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ5.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ7.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | LZ6.mp3 | 2022-08-09 15:42 | 0 | |
![[SND]](/icons/sound2.gif) | Skofka_Nu_a_poki_budem_bit_vas_za_azov_i_Buchu.mp3 | 2022-08-09 15:41 | 0 | |
![[SND]](/icons/sound2.gif) | Eorp.mp3 | 2022-08-09 15:39 | 0 | |
![[SND]](/icons/sound2.gif) | high.mp3 | 2022-08-09 15:38 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rizky Febian Seperti Kisah Official Lyric Video.mp3 | 2022-08-09 15:37 | 0 | |
![[SND]](/icons/sound2.gif) | LZ.mp3 | 2022-08-09 15:36 | 2.4M | |
![[SND]](/icons/sound2.gif) | DJ BUILD A BITCH.mp3 | 2022-08-09 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง.mp3 | 2022-08-09 15:35 | 0 | |
![[SND]](/icons/sound2.gif) | ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง (online-audio-converter.com).mp3 | 2022-08-09 15:34 | 0 | |
![[SND]](/icons/sound2.gif) | nai.mp3 | 2022-08-09 15:32 | 0 | |
![[SND]](/icons/sound2.gif) | vadcb.mp3 | 2022-08-09 15:29 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - iPhone New phone ringtone 2020 Best iPhone ringtone 2020 Apple ringtone 2020 download.mp3 | 2022-08-09 15:27 | 0 | |
![[SND]](/icons/sound2.gif) | Song10.mp3 | 2022-08-09 15:26 | 0 | |
![[SND]](/icons/sound2.gif) | HEE.mp3 | 2022-08-09 15:20 | 2.8M | |
![[SND]](/icons/sound2.gif) | y2mate.com - I Like You So Much Youll Know It Ysabelle Cuevas Lyrics .mp3 | 2022-08-09 15:15 | 1.0M | |
![[SND]](/icons/sound2.gif) | jackking.mp3 | 2022-08-09 15:14 | 0 | |
![[SND]](/icons/sound2.gif) | megalovania.mp3 | 2022-08-09 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | mp3-2217615439921085-160687952498285.mp3 | 2022-08-09 15:13 | 0 | |
![[SND]](/icons/sound2.gif) | bls9.mp3 | 2022-08-09 15:12 | 0 | |
![[SND]](/icons/sound2.gif) | zaxn1.mp3 | 2022-08-09 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | life.mp3 | 2022-08-09 15:10 | 0 | |
![[SND]](/icons/sound2.gif) | joby102.mp3 | 2022-08-09 15:06 | 0 | |
![[SND]](/icons/sound2.gif) | ransom.mp3 | 2022-08-09 15:04 | 0 | |
![[SND]](/icons/sound2.gif) | incalabas3.mp3 | 2022-08-09 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | U-Rays (Tutorial) - F-Zero GX [OST].mp3 | 2022-08-09 15:03 | 232K | |
![[SND]](/icons/sound2.gif) | oopkmmmm.mp3 | 2022-08-09 15:03 | 0 | |
![[SND]](/icons/sound2.gif) | 9amincalabasas.mp3 | 2022-08-09 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | ll1.mp3 | 2022-08-09 15:02 | 0 | |
![[SND]](/icons/sound2.gif) | FFMAX.mp3 | 2022-08-09 15:00 | 0 | |
![[SND]](/icons/sound2.gif) | kkkkkkkho.mp3 | 2022-08-09 14:59 | 3.1M | |
![[SND]](/icons/sound2.gif) | walk.mp3 | 2022-08-09 14:59 | 4.2M | |
![[SND]](/icons/sound2.gif) | chuta5.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta4.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta3.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta2.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | chuta1.mp3 | 2022-08-09 14:58 | 0 | |
![[SND]](/icons/sound2.gif) | Travis Scott - Antidote (Lyrics On Screen).mp3 | 2022-08-09 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Arctic Monkeys I Wanna Be Yours Lyrics.mp3 | 2022-08-09 14:56 | 0 | |
![[SND]](/icons/sound2.gif) | CallGirl-TrungTu-7344918.mp3 | 2022-08-09 14:53 | 0 | |
![[SND]](/icons/sound2.gif) | Redoxy Был друг стал враг_9zbk.mp3 | 2022-08-09 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | vacation.mp3 | 2022-08-09 14:50 | 0 | |
![[SND]](/icons/sound2.gif) | uuwian.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | paypal-hold-song.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | savage.mp3 | 2022-08-09 14:49 | 0 | |
![[SND]](/icons/sound2.gif) | options.mp3 | 2022-08-09 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | lintik.mp3 | 2022-08-09 14:48 | 0 | |
![[SND]](/icons/sound2.gif) | lifegoeson.mp3 | 2022-08-09 14:48 | 3.2M | |
![[SND]](/icons/sound2.gif) | kungikay.mp3 | 2022-08-09 14:47 | 1.5M | |
![[SND]](/icons/sound2.gif) | itsyou.mp3 | 2022-08-09 14:47 | 1.5M | |
![[SND]](/icons/sound2.gif) | ispy.mp3 | 2022-08-09 14:47 | 0 | |
![[SND]](/icons/sound2.gif) | heatwaves.mp3 | 2022-08-09 14:47 | 3.2M | |
![[SND]](/icons/sound2.gif) | habangbuhay.mp3 | 2022-08-09 14:46 | 3.8M | |
![[SND]](/icons/sound2.gif) | deathbed.mp3 | 2022-08-09 14:46 | 1.1M | |
![[SND]](/icons/sound2.gif) | comethru.mp3 | 2022-08-09 14:46 | 0 | |
![[SND]](/icons/sound2.gif) | chilllang.mp3 | 2022-08-09 14:46 | 4.5M | |
![[SND]](/icons/sound2.gif) | buwan.mp3 | 2022-08-09 14:45 | 7.8M | |
![[SND]](/icons/sound2.gif) | bilog.mp3 | 2022-08-09 14:45 | 1.5M | |
![[SND]](/icons/sound2.gif) | beautiful.mp3 | 2022-08-09 14:45 | 4.5M | |
![[SND]](/icons/sound2.gif) | io1.mp3 | 2022-08-09 14:41 | 0 | |
![[SND]](/icons/sound2.gif) | Pa.mp3 | 2022-08-09 14:39 | 0 | |
![[SND]](/icons/sound2.gif) | Pala1.mp3 | 2022-08-09 14:38 | 0 | |
![[SND]](/icons/sound2.gif) | Tiara01.mp3 | 2022-08-09 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | snowfall.mp3 | 2022-08-09 14:37 | 0 | |
![[SND]](/icons/sound2.gif) | wells-hold-song.mp3 | 2022-08-09 14:37 | 1.3M | |
![[SND]](/icons/sound2.gif) | prokol.mp3.mp3 | 2022-08-09 14:36 | 0 | |
![[SND]](/icons/sound2.gif) | Glen1.mp3 | 2022-08-09 14:34 | 0 | |
![[SND]](/icons/sound2.gif) | Pala.mp3 | 2022-08-09 14:33 | 1.5M | |
![[SND]](/icons/sound2.gif) | Newsong70.mp3 | 2022-08-09 14:31 | 0 | |
![[SND]](/icons/sound2.gif) | Glen17.mp3 | 2022-08-09 14:31 | 1.1M | |
![[SND]](/icons/sound2.gif) | topromanticsong.mp3 | 2022-08-09 14:31 | 0 | |
![[SND]](/icons/sound2.gif) | PALEDES.mp3 | 2022-08-09 14:28 | 0 | |
![[SND]](/icons/sound2.gif) | bass.mp3 | 2022-08-09 14:28 | 4.9M | |
![[SND]](/icons/sound2.gif) | djcuky2.mp3 | 2022-08-09 14:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Wells Fargo Hold Music (2021).mp3 | 2022-08-09 14:21 | 1.3M | |
![[SND]](/icons/sound2.gif) | Theo1.mp3 | 2022-08-09 14:21 | 135K | |
![[SND]](/icons/sound2.gif) | Sukzessive Approximation (DJ Cannabis Coffeeshops Deutschland).mp3 | 2022-08-09 14:20 | 0 | |
![[SND]](/icons/sound2.gif) | 2019-03-17_-_Too_Crazy_-_David_Fesliyan.mp3 | 2022-08-09 14:19 | 0 | |
![[SND]](/icons/sound2.gif) | Lucky1.mp3 | 2022-08-09 14:14 | 0 | |
![[SND]](/icons/sound2.gif) | Sad3.mp3 | 2022-08-09 14:13 | 840K | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Joji - Glimpse of Us (320kbps).mp3 | 2022-08-09 14:10 | 8.9M | |
![[SND]](/icons/sound2.gif) | VaGanza.mp3 | 2022-08-09 14:10 | 0 | |
![[SND]](/icons/sound2.gif) | [YT2mp3.info] - Beach Bunny - Cloud 9 (Official Music Video) (320kbps).mp3 | 2022-08-09 14:09 | 0 | |
![[SND]](/icons/sound2.gif) | rascal.mp3 | 2022-08-09 14:05 | 0 | |
![[SND]](/icons/sound2.gif) | Highway.mp3 | 2022-08-09 14:03 | 0 | |
![[SND]](/icons/sound2.gif) | FullSenyum.mp3 | 2022-08-09 13:59 | 4.2M | |
![[SND]](/icons/sound2.gif) | LOVE.mp3 | 2022-08-09 13:59 | 0 | |
![[SND]](/icons/sound2.gif) | panda.mp3 | 2022-08-09 13:56 | 4.8M | |
![[SND]](/icons/sound2.gif) | PecahSeribu.mp3 | 2022-08-09 13:56 | 0 | |
![[SND]](/icons/sound2.gif) | test1.mp3 | 2022-08-09 13:54 | 4.2M | |
![[SND]](/icons/sound2.gif) | life3.mp3 | 2022-08-09 13:53 | 0 | |
![[SND]](/icons/sound2.gif) | cars1.mp3 | 2022-08-09 13:52 | 0 | |
![[SND]](/icons/sound2.gif) | Djfede1.mp3 | 2022-08-09 13:48 | 0 | |
![[SND]](/icons/sound2.gif) | kolor.mp3 | 2022-08-09 13:46 | 0 | |
![[SND]](/icons/sound2.gif) | SAMSONS.mp3 | 2022-08-09 13:44 | 0 | |
![[SND]](/icons/sound2.gif) | ganda.mp3 | 2022-08-09 13:40 | 0 | |
![[SND]](/icons/sound2.gif) | Hills.mp3 | 2022-08-09 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | PARALUMAN.mp3 | 2022-08-09 13:39 | 0 | |
![[SND]](/icons/sound2.gif) | RagnBone Man - Human.mp3 | 2022-08-09 13:35 | 0 | |
![[SND]](/icons/sound2.gif) | prombl_-_myulee_(musmore.com).mp3 | 2022-08-09 13:30 | 0 | |
![[SND]](/icons/sound2.gif) | Sweet.mp3 | 2022-08-09 13:28 | 3.4M | |
![[SND]](/icons/sound2.gif) | Mehabooba.mp3 | 2022-08-09 13:27 | 1.2M | |
![[SND]](/icons/sound2.gif) | Chill.mp3 | 2022-08-09 13:25 | 72K | |
![[SND]](/icons/sound2.gif) | Bmw.mp3 | 2022-08-09 13:24 | 2.5M | |
![[SND]](/icons/sound2.gif) | abtag5.mp3 | 2022-08-09 13:22 | 0 | |
![[SND]](/icons/sound2.gif) | moonnik.mp3 | 2022-08-09 13:19 | 0 | |
![[SND]](/icons/sound2.gif) | MOON.mp3 | 2022-08-09 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | THUONGQUAXA.mp3 | 2022-08-09 13:17 | 0 | |
![[SND]](/icons/sound2.gif) | united in flames cut.mp3 | 2022-08-09 13:16 | 0 | |
![[SND]](/icons/sound2.gif) | KaiZ2.mp3 | 2022-08-09 13:13 | 0 | |
![[SND]](/icons/sound2.gif) | EroplanongPapel.mp3 | 2022-08-09 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | Until5.mp3 | 2022-08-09 13:12 | 0 | |
![[SND]](/icons/sound2.gif) | Idealessappealing.mp3 | 2022-08-09 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | AMALEDI (1).mp3 | 2022-08-09 13:09 | 0 | |
![[SND]](/icons/sound2.gif) | PTT-20220809-WA0025.mp3 | 2022-08-09 13:08 | 0 | |
![[SND]](/icons/sound2.gif) | box.mp3 | 2022-08-09 13:08 | 1.8M | |
![[SND]](/icons/sound2.gif) | Fai Rumore (ESC 2022 SF1 Live).mp3 | 2022-08-09 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | Asmodeus - AI.mp3 | 2022-08-09 13:07 | 0 | |
![[SND]](/icons/sound2.gif) | y2meta.com - Last Child - DUKA (Official Lyric Video) (128 kbps).mp3 | 2022-08-09 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1659706519639.mp3 | 2022-08-09 13:05 | 0 | |
![[SND]](/icons/sound2.gif) | Beruntung.mp3 | 2022-08-09 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | Asmodeus - AI.m4a | 2022-08-09 13:04 | 0 | |
![[SND]](/icons/sound2.gif) | parti2.mp3 | 2022-08-09 13:01 | 0 | |
![[SND]](/icons/sound2.gif) | playlist-sad-2hour.mp3 | 2022-08-09 13:00 | 0 | |
![[SND]](/icons/sound2.gif) | haroun.mp3 | 2022-08-09 12:58 | 0 | |
![[SND]](/icons/sound2.gif) | Rain World THS - Garbage City Shuffle.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | dangdutslebew1.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | inbound4252352553164717993.mp3 | 2022-08-09 12:55 | 0 | |
![[SND]](/icons/sound2.gif) | snap1.mp3 | 2022-08-09 12:54 | 0 | |
![[SND]](/icons/sound2.gif) | tegar.mp3 | 2022-08-09 12:52 | 3.6M | |
![[SND]](/icons/sound2.gif) | Darci2.mp3 | 2022-08-09 12:51 | 0 | |
![[SND]](/icons/sound2.gif) | Big_Baby_Tape_kizaru_-_99_Problems_73212020.mp3 | 2022-08-09 12:51 | 6.2M | |
![[SND]](/icons/sound2.gif) | better.mp3 | 2022-08-09 12:50 | 3.2M | |
![[SND]](/icons/sound2.gif) | y2mate.com - Eyes blue or brown cant remember terpikat senyummu Heather X Eyes Blue Lirik Dan Terjemahan.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | Luha.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y5.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y4.mp3 | 2022-08-09 12:50 | 0 | |
![[SND]](/icons/sound2.gif) | y2.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | y3.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | y1.mp3 | 2022-08-09 12:49 | 0 | |
![[SND]](/icons/sound2.gif) | Ballin Down.mp3 | 2022-08-09 12:47 | 0 | |
![[SND]](/icons/sound2.gif) | Porque.mp3 | 2022-08-09 12:45 | 0 | |
![[SND]](/icons/sound2.gif) | mp1.mp3 | 2022-08-09 12:41 | 1.7M | |
![[SND]](/icons/sound2.gif) | Darci.mp3 | 2022-08-09 12:39 | 0 | |
![[SND]](/icons/sound2.gif) | Kambulat — Но ты кидаешь в игнор (Muzqa.net) (www.lightaudio.ru).mp3 | 2022-08-09 12:38 | 0 | |
![[SND]](/icons/sound2.gif) | Empilight.mp3 | 2022-08-09 12:36 | 0 | |
![[SND]](/icons/sound2.gif) | Oliver.mp3 | 2022-08-09 12:36 | 0 | |
![[SND]](/icons/sound2.gif) | ЛИТВИНЕНКО - Исправим.mp3 | 2022-08-09 12:36 | 2.4M | |
![[SND]](/icons/sound2.gif) | y2mate.com - DARCION MY OWN LYRICS.mp3 | 2022-08-09 12:35 | 0 | |
![[SND]](/icons/sound2.gif) | JIKA.mp3 | 2022-08-09 12:32 | 0 | |
![[SND]](/icons/sound2.gif) | Har20.mp3 | 2022-08-09 12:31 | 3.6M | |
![[SND]](/icons/sound2.gif) | tiengxehoi.mp3 | 2022-08-09 12:21 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - New GM ChevyGMCCadillac Door Chime Sound Effect HQ.mp3 | 2022-08-09 12:20 | 0 | |
![[SND]](/icons/sound2.gif) | adsasdasd.mp3 | 2022-08-09 12:12 | 0 | |
![[SND]](/icons/sound2.gif) | vjudjhfgkvgz.mp3 | 2022-08-09 12:11 | 0 | |
![[SND]](/icons/sound2.gif) | bollywoodFM - Детство.mp3 | 2022-08-09 12:11 | 3.0M | |
![[SND]](/icons/sound2.gif) | 1650353842_2xrkrnskpsn2022rk8fbcq0k128kbs.mp3 | 2022-08-09 12:08 | 8.8M | |
![[SND]](/icons/sound2.gif) | washing.mp3 | 2022-08-09 12:05 | 1.8M | |
![[SND]](/icons/sound2.gif) | mscrumby.mp3 | 2022-08-09 12:04 | 2.1M | |
![[SND]](/icons/sound2.gif) | nokomens.mp3 | 2022-08-09 11:54 | 5.9M | |
![[SND]](/icons/sound2.gif) | rfquake.mp3 | 2022-08-09 11:52 | 4.2M | |
![[SND]](/icons/sound2.gif) | lmanana.mp3 | 2022-08-09 11:51 | 8.8M | |
![[SND]](/icons/sound2.gif) | crmby.mp3 | 2022-08-09 11:51 | 2.1M | |
![[SND]](/icons/sound2.gif) | campuran.mp3 | 2022-08-09 11:48 | 53M | |
![[SND]](/icons/sound2.gif) | Crazy - Patrick Patrikios.mp3 | 2022-08-09 11:44 | 5.1M | |
![[SND]](/icons/sound2.gif) | s2.mp3 | 2022-08-09 11:38 | 4.3M | |
![[SND]](/icons/sound2.gif) | 10.mp3 | 2022-08-09 11:35 | 172K | |
![[SND]](/icons/sound2.gif) | Iskorpio - MABAGHICH (Official Music Audio).[Mpgun.com].mp3 | 2022-08-09 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | naruto.mp3 | 2022-08-09 11:32 | 0 | |
![[SND]](/icons/sound2.gif) | rege2.mp3 | 2022-08-09 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | XD.mp3 | 2022-08-09 11:31 | 0 | |
![[SND]](/icons/sound2.gif) | KarnaMereka - Cerita Malam (Lirik).mp3 | 2022-08-09 11:30 | 0 | |
![[SND]](/icons/sound2.gif) | Randa1.mp3 | 2022-08-09 11:29 | 1.5M | |
![[SND]](/icons/sound2.gif) | Akin.mp3 | 2022-08-09 11:28 | 0 | |
![[SND]](/icons/sound2.gif) | dopan.mp3 | 2022-08-09 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | KLIA.mp3 | 2022-08-09 11:27 | 0 | |
![[SND]](/icons/sound2.gif) | vtornik_-_Dzhoni_Vonker_73215538.mp3 | 2022-08-09 11:25 | 0 | |
![[SND]](/icons/sound2.gif) | mp5.mp3 | 2022-08-09 11:25 | 4.9M | |
![[SND]](/icons/sound2.gif) | listrap1.mp3 | 2022-08-09 11:24 | 22M | |
![[SND]](/icons/sound2.gif) | listrap.mp3 | 2022-08-09 11:24 | 19M | |
![[SND]](/icons/sound2.gif) | KVA1.mp3 | 2022-08-09 11:21 | 128K | |
![[SND]](/icons/sound2.gif) | kelaz.mp3 | 2022-08-09 11:16 | 0 | |
![[SND]](/icons/sound2.gif) | ha1.mp3 | 2022-08-09 11:16 | 1.8M | |
![[SND]](/icons/sound2.gif) | mp3.mp3 | 2022-08-09 11:15 | 1.1M | |
![[SND]](/icons/sound2.gif) | AUD-20220124-WA0172.mp3 | 2022-08-09 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | SNA.mp3 | 2022-08-09 11:13 | 0 | |
![[SND]](/icons/sound2.gif) | Кино - Закрой за мной дверь, я ухожу.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | no3.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | SHINE7.mp3 | 2022-08-09 11:12 | 0 | |
![[SND]](/icons/sound2.gif) | Beethoven Violin concerto 3rd movement, Toshiya Eto soloist.mp3 | 2022-08-09 11:11 | 0 | |
![[SND]](/icons/sound2.gif) | no1.mp3 | 2022-08-09 11:09 | 0 | |
![[VID]](/icons/movie.gif) | WhatsApp Audio 2022-08-08 at 11.06.32 AM.mp4 | 2022-08-09 11:09 | 0 | |
![[SND]](/icons/sound2.gif) | no2.mp3 | 2022-08-09 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | Jakomo, A.V.G, MACAN - Самый молодой.mp3 | 2022-08-09 11:08 | 0 | |
![[SND]](/icons/sound2.gif) | 🔊💣😈Iliusha🔊💣😈-🖤 Пару водников 🖤-kissvk.com.mp3 | 2022-08-09 11:07 | 0 | |
![[SND]](/icons/sound2.gif) | ТГК - Там таз стелит.mp3 | 2022-08-09 11:07 | 1.0M | |
![[SND]](/icons/sound2.gif) | ha.mp3 | 2022-08-09 11:06 | 2.0M | |
![[SND]](/icons/sound2.gif) | ilja_toka__tutbass_-_ilja_toka__tam__gde_nam_ksenon_osveshchaet_tuman_(z2.fm).mp3 | 2022-08-09 11:03 | 6.6M | |
![[VID]](/icons/movie.gif) | DJ1.mp4 | 2022-08-09 11:02 | 0 | |
![[SND]](/icons/sound2.gif) | PD.mp3 | 2022-08-09 10:59 | 2.3M | |
![[SND]](/icons/sound2.gif) | Диман Брюханов - Давай вкатаемся братан_(muzfan.net).mp3 | 2022-08-09 10:59 | 7.1M | |
![[SND]](/icons/sound2.gif) | sed1.mp3 | 2022-08-09 10:58 | 0 | |
![[SND]](/icons/sound2.gif) | Liam1.mp3 | 2022-08-09 10:57 | 7.5M | |
![[SND]](/icons/sound2.gif) | Mr. Credo - Медляк (CXNVTVS flip) (www.hotplayer.ru).mp3 | 2022-08-09 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | ask.mp3 | 2022-08-09 10:56 | 0 | |
![[SND]](/icons/sound2.gif) | Randa3.mp3 | 2022-08-09 10:55 | 0 | |
![[SND]](/icons/sound2.gif) | SM.mp3 | 2022-08-09 10:55 | 3.0M | |
![[SND]](/icons/sound2.gif) | Randa.mp3 | 2022-08-09 10:54 | 3.4M | |
![[SND]](/icons/sound2.gif) | Chin-Giz - Ствол.mp3 | 2022-08-09 10:53 | 5.5M | |
![[SND]](/icons/sound2.gif) | Need You Lyrics Ex Battalion ft Jroa.mp3 | 2022-08-09 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | PLVTINUM Tarro Champagne Sunshine Lyrics British men do it best TikTok Song.mp3 | 2022-08-09 10:50 | 0 | |
![[SND]](/icons/sound2.gif) | tite.mp3 | 2022-08-09 10:49 | 0 | |
![[SND]](/icons/sound2.gif) | gamitin nang babae.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | The Walters I Love You So.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | Like A Virgin Lyrics Video Madonna.mp3 | 2022-08-09 10:48 | 0 | |
![[SND]](/icons/sound2.gif) | Aqua Barbie Girl.mp3 | 2022-08-09 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | Lo Ki Manifest Official Music Video.mp3 | 2022-08-09 10:47 | 1.4M | |
![[SND]](/icons/sound2.gif) | David3.mp3 | 2022-08-09 10:47 | 2.3M | |
![[SND]](/icons/sound2.gif) | Philippine National Anthem Lupang Hinirang TLEN.mp3 | 2022-08-09 10:47 | 0 | |
![[SND]](/icons/sound2.gif) | PH.mp3 | 2022-08-09 10:44 | 0 | |
![[SND]](/icons/sound2.gif) | SPEEDY SOUNDS & ENTERTAINMENT PIANO MIX #003.mp3 | 2022-08-09 10:42 | 0 | |
![[SND]](/icons/sound2.gif) | Who's Lovin You.mp3 | 2022-08-09 10:40 | 0 | |
![[SND]](/icons/sound2.gif) | Tickle me pink.mp3 | 2022-08-09 10:39 | 0 | |
![[SND]](/icons/sound2.gif) | Lintik.mp3 | 2022-08-09 10:37 | 0 | |
![[SND]](/icons/sound2.gif) | sbw1.mp3 | 2022-08-09 10:36 | 0 | |
![[SND]](/icons/sound2.gif) | dgn1.mp3 | 2022-08-09 10:33 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Juice WRLD The Weeknd Smile Official Video.mp3 | 2022-08-09 10:29 | 0 | |
![[SND]](/icons/sound2.gif) | joji_glimpse_of_us_1062941230036325777.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | djsalira.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | Joji-SLOW-DANCING-IN-THE-DARK_K3Qzzggn--s.mp3 | 2022-08-09 10:28 | 0 | |
![[SND]](/icons/sound2.gif) | before-I-close-my-eyes_2EpBqtqf8Go.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Juice WRLD Empty Official Audio.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rich Brian Yellow ft Bekon Official Video.mp3 | 2022-08-09 10:27 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - Rich Brian Drive Safe Lyric Video.mp3 | 2022-08-09 10:26 | 0 | |
![[SND]](/icons/sound2.gif) | 想見你.mp3 | 2022-08-09 10:22 | 1.8M | |
![[SND]](/icons/sound2.gif) | atlanta.mp3 | 2022-08-09 10:19 | 4.4M | |
![[SND]](/icons/sound2.gif) | beatgat1.mp3 | 2022-08-09 10:19 | 220K | |
![[SND]](/icons/sound2.gif) | beatgat.mp3 | 2022-08-09 10:19 | 2.5M | |
![[SND]](/icons/sound2.gif) | beat1.mp3 | 2022-08-09 10:19 | 2.3M | |
![[SND]](/icons/sound2.gif) | morgenshtern-timati-el-problema-mp3.mp3 | 2022-08-09 10:16 | 5.3M | |
![[SND]](/icons/sound2.gif) | trekkkk.mp3 | 2022-08-09 10:13 | 0 | |
![[SND]](/icons/sound2.gif) | alt-J - Breezeblocks (Lyrics).mp3 | 2022-08-09 10:11 | 0 | |
![[SND]](/icons/sound2.gif) | -_Pro_samp_rp_(Gybka.com).mp3 | 2022-08-09 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | morgenshtern-eldzhej-cadillac-club-remix-by-skazka-music-mp3.mp3 | 2022-08-09 10:09 | 0 | |
![[SND]](/icons/sound2.gif) | lexzy3.mp3 | 2022-08-09 10:06 | 0 | |
![[SND]](/icons/sound2.gif) | sasageo.mp3 | 2022-08-09 10:05 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_1.mp3 | 2022-08-09 10:02 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_11.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_12.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_2.mp3 | 2022-08-09 10:01 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_7.mp3 | 2022-08-09 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_13.mp3 | 2022-08-09 09:59 | 0 | |
![[SND]](/icons/sound2.gif) | Miyagi, Andy Panda - Utopia (mp3day.net).mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_6.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_9.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_4.mp3 | 2022-08-09 09:58 | 0 | |
![[SND]](/icons/sound2.gif) | FAJRIA.mp3 | 2022-08-09 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_10.mp3 | 2022-08-09 09:57 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_3.mp3 | 2022-08-09 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | ganvest-durnaya-mp3.mp3 | 2022-08-09 09:56 | 0 | |
![[SND]](/icons/sound2.gif) | для мта 8 — военкомат (www.lightaudio.ru).mp3 | 2022-08-09 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | Happy Asmara - Tatu [OFFICIAL].mp3 | 2022-08-09 09:53 | 0 | |
![[SND]](/icons/sound2.gif) | WOW.mp3 | 2022-08-09 09:51 | 0 | |
![[SND]](/icons/sound2.gif) | lexzy1.mp3 | 2022-08-09 09:49 | 0 | |
![[SND]](/icons/sound2.gif) | love3.mp3 | 2022-08-09 09:48 | 0 | |
![[SND]](/icons/sound2.gif) | hcdbf.mp3 | 2022-08-09 09:47 | 0 | |
![[SND]](/icons/sound2.gif) | Djpk1.mp3 | 2022-08-09 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | Ебанько - Я ебу собак.mp3 | 2022-08-09 09:46 | 2.2M | |
![[SND]](/icons/sound2.gif) | AUD-20220809-WA0308.mp3 | 2022-08-09 09:46 | 0 | |
![[SND]](/icons/sound2.gif) | efekgedhangkluthuk.mp3 | 2022-08-09 09:35 | 0 | |
![[SND]](/icons/sound2.gif) | qwe.mp3 | 2022-08-09 09:31 | 2.6M | |
![[SND]](/icons/sound2.gif) | ⛱ Travel Vlog No Copyright Chill Summer Background Music for Video _ Anywhere by shandr & Nick Perry (2).mp3 | 2022-08-09 09:31 | 0 | |
![[SND]](/icons/sound2.gif) | Ебанько - Еби меня.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_5.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | atme.mp3 | 2022-08-09 09:30 | 0 | |
![[SND]](/icons/sound2.gif) | phulu.mp3 | 2022-08-09 09:27 | 0 | |
![[SND]](/icons/sound2.gif) | AUD-20220809-WA0314.m4a | 2022-08-09 09:27 | 0 | |
![[SND]](/icons/sound2.gif) | remixx.mp3 | 2022-08-09 09:25 | 0 | |
![[SND]](/icons/sound2.gif) | duka.mp3 | 2022-08-09 09:23 | 5.1M | |
![[VID]](/icons/movie.gif) | sms.mp4 | 2022-08-09 09:19 | 78K | |
![[VID]](/icons/movie.gif) | GABUT2.mp4 | 2022-08-09 09:17 | 0 | |
![[VID]](/icons/movie.gif) | GABUT1.mp4 | 2022-08-09 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | india.mp3 | 2022-08-09 09:17 | 0 | |
![[SND]](/icons/sound2.gif) | dangdut3.mp3 | 2022-08-09 09:16 | 0 | |
![[SND]](/icons/sound2.gif) | dangdut2.mp3 | 2022-08-09 09:16 | 1.4M | |
![[SND]](/icons/sound2.gif) | Baby.mp3 | 2022-08-09 09:15 | 2.0M | |
![[SND]](/icons/sound2.gif) | gamora_-_bazaru_net_(z2.fm).mp3 | 2022-08-09 09:08 | 0 | |
![[VID]](/icons/movie.gif) | VID-20220731-WA0012.mp4 | 2022-08-09 09:08 | 3.1M | |
![[SND]](/icons/sound2.gif) | Dije2.mp3 | 2022-08-09 09:07 | 2.7M | |
![[VID]](/icons/movie.gif) | VID-20220724-WA0006.mp4 | 2022-08-09 09:07 | 0 | |
![[SND]](/icons/sound2.gif) | Joko tingkirr.mp3 | 2022-08-09 09:06 | 5.3M | |
![[SND]](/icons/sound2.gif) | Awd1.mp3 | 2022-08-09 09:03 | 148K | |
![[SND]](/icons/sound2.gif) | Asb1.mp3 | 2022-08-09 08:59 | 0 | |
![[SND]](/icons/sound2.gif) | CN - Atomwaffen Division.mp3 | 2022-08-09 08:56 | 0 | |
![[SND]](/icons/sound2.gif) | Brk1.mp3 | 2022-08-09 08:50 | 0 | |
![[SND]](/icons/sound2.gif) | bro2.mp3 | 2022-08-09 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Dd1.mp3 | 2022-08-09 08:47 | 0 | |
![[SND]](/icons/sound2.gif) | Gg33.mp3 | 2022-08-09 08:47 | 400K | |
![[SND]](/icons/sound2.gif) | PANICX, SH3TLVIZ - Give Em Hell.mp3 | 2022-08-09 08:45 | 0 | |
![[SND]](/icons/sound2.gif) | Strom1.mp3 | 2022-08-09 08:44 | 0 | |
![[SND]](/icons/sound2.gif) | Music Cover l 66,We are Badguy,JAK Founder (RB Version).mp3 | 2022-08-09 08:42 | 0 | |
![[SND]](/icons/sound2.gif) | TBA.mp3 | 2022-08-09 08:38 | 0 | |
![[SND]](/icons/sound2.gif) | tose1.mp3 | 2022-08-09 08:36 | 0 | |
![[SND]](/icons/sound2.gif) | seto5.mp3 | 2022-08-09 08:31 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest5.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | renz1.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest2.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest3.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | AZBest1.mp3 | 2022-08-09 08:21 | 0 | |
![[SND]](/icons/sound2.gif) | Debt Collection - Outbound - Follow-up call.mp3 | 2022-08-09 08:20 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest4.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest2.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest1.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest5.mp3 | 2022-08-09 08:19 | 0 | |
![[SND]](/icons/sound2.gif) | AsiaZoneRPBest3.mp3 | 2022-08-09 08:18 | 0 | |
![[SND]](/icons/sound2.gif) | genggeng.mp3 | 2022-08-09 08:17 | 300K | |
![[SND]](/icons/sound2.gif) | 01 DJ CONRAY - HELLO SUMMER AMAPIANO MIX (1).mp3 | 2022-08-09 08:16 | 0 | |
![[SND]](/icons/sound2.gif) | gang.mp3 | 2022-08-09 08:12 | 0 | |
![[SND]](/icons/sound2.gif) | D42_3.mp3 | 2022-08-09 08:10 | 0 | |
![[SND]](/icons/sound2.gif) | vip3.mp3 | 2022-08-09 08:06 | 0 | |
![[SND]](/icons/sound2.gif) | D42_2.mp3 | 2022-08-09 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | D42_1.mp3 | 2022-08-09 08:05 | 0 | |
![[SND]](/icons/sound2.gif) | laskarpelangi.mp3 | 2022-08-09 08:04 | 3.1M | |
![[SND]](/icons/sound2.gif) | sabilulung.mp3 | 2022-08-09 08:03 | 2.6M | |
![[SND]](/icons/sound2.gif) | yt1s.com - Breaking Bad Main Title Theme Extended.mp3 | 2022-08-09 08:03 | 0 | |
![[SND]](/icons/sound2.gif) | partyfavor.mp3 | 2022-08-09 08:01 | 3.7M | |
![[SND]](/icons/sound2.gif) | vserana.mp3 | 2022-08-09 07:59 | 0 | |
![[SND]](/icons/sound2.gif) | DJ AINT MY FAULT SLOWED VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp3 | 2022-08-09 07:58 | 2.3M | |
![[SND]](/icons/sound2.gif) | D44.mp3 | 2022-08-09 07:57 | 232K | |
![[SND]](/icons/sound2.gif) | DJ+TELOLET+BY+DJ+SOPAN.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | D42.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | bibo.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | lc.mp3 | 2022-08-09 07:55 | 0 | |
![[SND]](/icons/sound2.gif) | asede.mp3 | 2022-08-09 07:54 | 0 | |
![[SND]](/icons/sound2.gif) | serana.mp3 | 2022-08-09 07:53 | 0 | |
![[SND]](/icons/sound2.gif) | cium.mp3 | 2022-08-09 07:52 | 0 | |
![[SND]](/icons/sound2.gif) | sempurna.mp3 | 2022-08-09 07:50 | 4.0M | |
![[SND]](/icons/sound2.gif) | love.mp3 | 2022-08-09 07:47 | 1.2M | |
![[SND]](/icons/sound2.gif) | bentrentanglau.mp3 | 2022-08-09 07:46 | 0 | |
![[SND]](/icons/sound2.gif) | beauty.mp3 | 2022-08-09 07:44 | 0 | |
![[SND]](/icons/sound2.gif) | december.mp3 | 2022-08-09 07:42 | 3.3M | |
![[SND]](/icons/sound2.gif) | kaso.mp3 | 2022-08-09 07:38 | 0 | |
![[SND]](/icons/sound2.gif) | loguo1.mp3 | 2022-08-09 07:37 | 2.4M | |
![[SND]](/icons/sound2.gif) | MAXMENGKEREN.mp3 | 2022-08-09 07:37 | 451K | |
![[SND]](/icons/sound2.gif) | xdhii1.mp3 | 2022-08-09 07:36 | 0 | |
![[SND]](/icons/sound2.gif) | 7125391394302429978.mp3 | 2022-08-09 07:35 | 0 | |
![[SND]](/icons/sound2.gif) | MuthukaleIkkaethittund.mp3 | 2022-08-09 07:33 | 0 | |
![[SND]](/icons/sound2.gif) | xz.mp3 | 2022-08-09 07:31 | 3.2M | |
![[SND]](/icons/sound2.gif) | co.mp3 | 2022-08-09 07:30 | 2.9M | |
![[SND]](/icons/sound2.gif) | hmaz1.mp3 | 2022-08-09 07:29 | 3.8M | |
![[SND]](/icons/sound2.gif) | AUD-20220729-WA0004.mp3 | 2022-08-09 07:28 | 209K | |
![[SND]](/icons/sound2.gif) | flyme.mp3 | 2022-08-09 07:27 | 2.9M | |
![[VID]](/icons/movie.gif) | 100.000.k_1659661158_musicaldown.com.mp4 | 2022-08-09 07:27 | 1.8M | |
![[SND]](/icons/sound2.gif) | secretlove.mp3 | 2022-08-09 07:26 | 3.8M | |
![[SND]](/icons/sound2.gif) | beachbunny1.mp3 | 2022-08-09 07:22 | 2.3M | |
![[SND]](/icons/sound2.gif) | acabo.mp3 | 2022-08-09 07:19 | 8.1M | |
![[SND]](/icons/sound2.gif) | remix2.mp3 | 2022-08-09 07:18 | 4.5M | |
![[SND]](/icons/sound2.gif) | kutahan.mp3 | 2022-08-09 07:17 | 1.2M | |
![[SND]](/icons/sound2.gif) | Radita.mp3 | 2022-08-09 07:11 | 120K | |
![[SND]](/icons/sound2.gif) | wonder.mp3 | 2022-08-09 07:08 | 2.7M | |
![[SND]](/icons/sound2.gif) | slow.mp3 | 2022-08-09 07:08 | 1.2M | |
![[SND]](/icons/sound2.gif) | phonk-killer-green-orxnge-madness_104015874.mp3 | 2022-08-09 07:03 | 0 | |
![[SND]](/icons/sound2.gif) | theshade.mp3 | 2022-08-09 06:59 | 1.9M | |
![[SND]](/icons/sound2.gif) | Sidekick.mp3 | 2022-08-09 06:55 | 0 | |
![[SND]](/icons/sound2.gif) | tam2000.mp3 | 2022-08-09 06:54 | 0 | |
![[SND]](/icons/sound2.gif) | yss.mp3 | 2022-08-09 06:51 | 0 | |
![[SND]](/icons/sound2.gif) | y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK (2).mp3 | 2022-08-09 06:43 | 0 | |
![[SND]](/icons/sound2.gif) | لحن حزين بدون كلمات 2021 - موسيقى حزينة تخليك تراجع أفعالك 💔.mp3 | 2022-08-09 06:42 | 0 | |
![[SND]](/icons/sound2.gif) | undertel.mp3 | 2022-08-09 06:39 | 0 | |
![[SND]](/icons/sound2.gif) | mxnarchNightwing.mp3 | 2022-08-09 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | 1630639076_fogel-bogatymi-2.mp3 | 2022-08-09 06:38 | 0 | |
![[SND]](/icons/sound2.gif) | bones-hdmi-chopped-and-screwed-by-hardhammi.mp3 | 2022-08-09 06:34 | 0 | |
![[SND]](/icons/sound2.gif) | Rock.mp3 | 2022-08-09 06:33 | 5.1M | |
![[SND]](/icons/sound2.gif) | 120080oon-120071eity-go_456240723.mp3 | 2022-08-09 06:32 | 0 | |
![[SND]](/icons/sound2.gif) | FindMyName - Show me your back.mp3 | 2022-08-09 06:31 | 0 | |
![[SND]](/icons/sound2.gif) | M.mp3 | 2022-08-09 06:31 | 2.4M | |
![[SND]](/icons/sound2.gif) | xxxmanera-NeverBrokeAgain(musmore.com).mp3 | 2022-08-09 06:30 | 0 | |
![[SND]](/icons/sound2.gif) | Canon.mp3 | 2022-08-09 06:29 | 0 | |
![[SND]](/icons/sound2.gif) | taktau.mp3 | 2022-08-09 06:26 | 1.2M | |
![[SND]](/icons/sound2.gif) | broker.mp3 | 2022-08-09 06:25 | 2.8M | |
![[SND]](/icons/sound2.gif) | Lugowo.mp3 | 2022-08-09 06:22 | 8.4M | |
![[SND]](/icons/sound2.gif) | y2mate.m4a | 2022-08-09 06:21 | 958K | |
![[SND]](/icons/sound2.gif) | geng02.mp3 | 2022-08-09 06:20 | 2.6M | |
![[SND]](/icons/sound2.gif) | geng01.mp3 | 2022-08-09 06:20 | 4.4M | |
![[SND]](/icons/sound2.gif) | s8.mp3 | 2022-08-09 06:17 | 0 | |
![[SND]](/icons/sound2.gif) | Neo.mp3 | 2022-08-09 06:16 | 0 | |
![[SND]](/icons/sound2.gif) | DIL2.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | DIL1.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | DIL3.mp3 | 2022-08-09 06:14 | 0 | |
![[SND]](/icons/sound2.gif) | final_62f18d113ce3bf0066abf1b0_130277.mp3 | 2022-08-09 06:08 | 0 | |
![[SND]](/icons/sound2.gif) | prescriptionkid.mp3 | 2022-08-09 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Ito Ang Liga PBA.mp3 | 2022-08-09 06:07 | 0 | |
![[SND]](/icons/sound2.gif) | Djviraltt.mp3 | 2022-08-09 06:04 | 0 | |
![[SND]](/icons/sound2.gif) | dappam.mp3.mp3 | 2022-08-09 06:01 | 0 | |
![[SND]](/icons/sound2.gif) | die.mp3 | 2022-08-09 05:58 | 4.0M | |
![[SND]](/icons/sound2.gif) | One.mp3 | 2022-08-09 05:56 | 4.2M | |
![[SND]](/icons/sound2.gif) | [lagu1s.com]TRICKSTER ANTHEM.oE6DQp1BAP8.mp3 | 2022-08-09 05:54 | 0 | |
![[SND]](/icons/sound2.gif) | Czerny op.849 no.1.mp3 | 2022-08-09 05:52 | 0 | |
![[SND]](/icons/sound2.gif) | teriak.mp3 | 2022-08-09 05:49 | 3.3M | |
![[SND]](/icons/sound2.gif) | tipex.mp3 | 2022-08-09 05:46 | 2.7M | |
![[SND]](/icons/sound2.gif) | ssstik_1652526939748.mp3 | 2022-08-09 05:46 | 0 | |
![[SND]](/icons/sound2.gif) | ssstik.io_1653374373576.mp3 | 2022-08-09 05:44 | 0 | |
![[SND]](/icons/sound2.gif) | ZentaMusicyea.mp3 | 2022-08-09 05:44 | 0 | |
![[SND]](/icons/sound2.gif) | Opasnyjj_-_Opasnyjj_khud_71073513.mp3 | 2022-08-09 05:43 | 0 | |
![[SND]](/icons/sound2.gif) | JEldzhi_-_Mojj_Rajjon_69081944.mp3 | 2022-08-09 05:42 | 0 | |
![[SND]](/icons/sound2.gif) | Sektor_Gaza_-_CHastushki_55189352.mp3 | 2022-08-09 05:38 | 7.7M | |
![[SND]](/icons/sound2.gif) | s5.mp3 | 2022-08-09 05:33 | 3.8M | |
![[SND]](/icons/sound2.gif) | the-smiths-the-boy-with-the-thorn-in-his-side.mp3 | 2022-08-09 05:32 | 0 | |
![[SND]](/icons/sound2.gif) | eldzhey-rastvoritel.mp3 | 2022-08-09 05:30 | 1.7M | |
![[SND]](/icons/sound2.gif) | set12.mp3 | 2022-08-09 05:29 | 2.9M | |
![[SND]](/icons/sound2.gif) | dreamgirl.mp3 | 2022-08-09 05:24 | 0 | |
![[SND]](/icons/sound2.gif) | ReZox8.mp3 | 2022-08-09 05:18 | 0 | |
![[SND]](/icons/sound2.gif) | WhereIsTheLove.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | seto3.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | DaEK4.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | seto2.mp3 | 2022-08-09 05:16 | 0 | |
![[SND]](/icons/sound2.gif) | Ton3.mp3 | 2022-08-09 05:15 | 0 | |
![[SND]](/icons/sound2.gif) | YraF5.mp3 | 2022-08-09 05:12 | 0 | |
![[SND]](/icons/sound2.gif) | Avtosh_-_Huligan_(iPleer.com).mp3 | 2022-08-09 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | BRDYVV_-_Avtosh_Xuligan_66898732.mp3 | 2022-08-09 05:11 | 0 | |
![[SND]](/icons/sound2.gif) | Fw5X.mp3 | 2022-08-09 05:09 | 0 | |
![[SND]](/icons/sound2.gif) | SrAf5.m4a | 2022-08-09 05:05 | 0 | |
![[SND]](/icons/sound2.gif) | GARa4s.mp3 | 2022-08-09 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | CYSec.mp3 | 2022-08-09 05:01 | 0 | |
![[SND]](/icons/sound2.gif) | ZhR24.mp3 | 2022-08-09 04:58 | 0 | |
![[SND]](/icons/sound2.gif) | dingincuy.mp3 | 2022-08-09 04:58 | 0 | |
![[SND]](/icons/sound2.gif) | SkrA5.mp3 | 2022-08-09 04:56 | 0 | |
![[SND]](/icons/sound2.gif) | LeeGa5.mp3 | 2022-08-09 04:53 | 0 | |
![[SND]](/icons/sound2.gif) | GaSt1.mp3 | 2022-08-09 04:51 | 0 | |
![[SND]](/icons/sound2.gif) | GaSt4.mp3 | 2022-08-09 04:49 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_HanyalahMimpi.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_YangKuInginkan.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Google.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Yasobi_Daijobu.mp3 | 2022-08-09 04:48 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Gustixa_Kobbo.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_7_Orange.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_JKT48_FortuneCookie.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_JKT48_SemutMerah.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Lofi_Bersamamu.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Vierra_YangKuInginkan.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | Ginn_Song_Vierra_Seandainya.mp3 | 2022-08-09 04:47 | 0 | |
![[SND]](/icons/sound2.gif) | CYS01Q.mp3 | 2022-08-09 04:45 | 0 | |
![[SND]](/icons/sound2.gif) | CloseYEyes.mp3 | 2022-08-09 04:43 | 0 | |
![[SND]](/icons/sound2.gif) | Dayang23.mp3 | 2022-08-09 04:37 | 7.5M | |
![[SND]](/icons/sound2.gif) | GaSt5.mp3 | 2022-08-09 04:36 | 5.9M | |
![[SND]](/icons/sound2.gif) | Nightcore - Demons.mp3 | 2022-08-09 04:35 | 5.1M | |
![[SND]](/icons/sound2.gif) | (Extended) Llusion X Banakula - Midnight Sun (Ramzoid Remix).mp3 | 2022-08-09 04:33 | 9.2M | |
![[SND]](/icons/sound2.gif) | Demi Lovato - Cool For The Summer [vzvuke.net].mp3 | 2022-08-09 04:33 | 0 | |
![[SND]](/icons/sound2.gif) | finikfinya__aleks_ataman_-_a_na_rukah_snezhinki_(z2.fm).mp3 | 2022-08-09 04:32 | 0 | |
![[SND]](/icons/sound2.gif) | fatbelly__abdr_-_bokal_(slowed_remix)_muzati.net.mp3 | 2022-08-09 04:28 | 0 | |
![[SND]](/icons/sound2.gif) | inbound2598099215265422569.mp3 | 2022-08-09 04:22 | 0 | |
![[SND]](/icons/sound2.gif) | BAGAIKAN LANGIT - POTRET Piano Cover (1).mp3 | 2022-08-09 04:21 | 0 | |
![[SND]](/icons/sound2.gif) | CYS.mp3 | 2022-08-09 04:17 | 0 | |
![[SND]](/icons/sound2.gif) | jdMga8.mp3 | 2022-08-09 04:15 | 0 | |
![[SND]](/icons/sound2.gif) | ftyuhbb.mp3 | 2022-08-09 04:14 | 0 | |
![[SND]](/icons/sound2.gif) | coli.mp3 | 2022-08-09 04:11 | 0 | |
![[SND]](/icons/sound2.gif) | Aga2Dj.mp3 | 2022-08-09 04:10 | 0 | |
![[SND]](/icons/sound2.gif) | gaR8f.mp3 | 2022-08-09 04:06 | 0 | |
![[SND]](/icons/sound2.gif) | united.mp3 | 2022-08-09 04:04 | 0 | |
![[SND]](/icons/sound2.gif) | Agazt2.mp3 | 2022-08-09 04:01 | 0 | |
![[SND]](/icons/sound2.gif) | XdaGa9.mp3 | 2022-08-09 03:58 | 0 | |
![[SND]](/icons/sound2.gif) | XdaGa1.mp3 | 2022-08-09 03:56 | 0 | |
![[SND]](/icons/sound2.gif) | GamonDek.mp3 | 2022-08-09 03:56 | 0 | |
![[SND]](/icons/sound2.gif) | pakwong.mp3 | 2022-08-09 03:51 | 4.3M | |
![[SND]](/icons/sound2.gif) | indah.mp3 | 2022-08-09 03:50 | 3.7M | |
![[SND]](/icons/sound2.gif) | derixs.mp3 | 2022-08-09 03:48 | 0 | |
![[SND]](/icons/sound2.gif) | AgaRa3.mp3 | 2022-08-09 03:46 | 1.7M | |
![[SND]](/icons/sound2.gif) | sai1.mp3 | 2022-08-09 03:45 | 0 | |
![[SND]](/icons/sound2.gif) | agS1r.mp3 | 2022-08-09 03:44 | 0 | |
![[SND]](/icons/sound2.gif) | KolxChill.mp3 | 2022-08-09 03:41 | 1.1M | |
![[SND]](/icons/sound2.gif) | drumsbums.mp3 | 2022-08-09 03:40 | 2.3M | |
![[SND]](/icons/sound2.gif) | elisha1.mp3 | 2022-08-09 03:39 | 404K | |
![[SND]](/icons/sound2.gif) | ABRAM.mp3 | 2022-08-09 03:39 | 391K | |
![[SND]](/icons/sound2.gif) | resah.mp3 | 2022-08-09 03:38 | 3.3M | |
![[SND]](/icons/sound2.gif) | AgRa4f.mp3 | 2022-08-09 03:38 | 352K | |
![[SND]](/icons/sound2.gif) | rumah.mp3 | 2022-08-09 03:35 | 2.2M | |
![[SND]](/icons/sound2.gif) | AgaTs3.mp3 | 2022-08-09 03:34 | 0 | |
![[SND]](/icons/sound2.gif) | BXBXK.mp3 | 2022-08-09 03:31 | 0 | |
![[SND]](/icons/sound2.gif) | rain.mp3 | 2022-08-09 03:30 | 1.7M | |
![[SND]](/icons/sound2.gif) | heaven.mp3 | 2022-08-09 03:29 | 5.4M | |
![[SND]](/icons/sound2.gif) | AgaT3.mp3 | 2022-08-09 03:28 | 0 | |
![[SND]](/icons/sound2.gif) | Ma.mp3 | 2022-08-09 03:26 | 1.1M | |
![[SND]](/icons/sound2.gif) | Mixx.mp3 | 2022-08-09 03:25 | 1.2M | |
![[SND]](/icons/sound2.gif) | Thin.mp3 | 2022-08-09 03:25 | 1.5M | |
![[SND]](/icons/sound2.gif) | KGF2.mp3 | 2022-08-09 03:24 | 0 | |
![[SND]](/icons/sound2.gif) | Ruth B. - Dandelions (Lyrics) slowed reverb (128 kbps) (YTmp3xd.com).mp3 | 2022-08-09 03:23 | 0 | |
![[SND]](/icons/sound2.gif) | ฉลามชอบงับคุณ - Bonnadol Feat IIVY B [ เนื้อเพลง ] (1).mp3 | 2022-08-09 03:23 | 2.9M | |
![[SND]](/icons/sound2.gif) | Rafae2.mp3 | 2022-08-09 03:21 | 0 | |
![[SND]](/icons/sound2.gif) | LOW.mp3 | 2022-08-09 03:17 | 0 | |
![[SND]](/icons/sound2.gif) | malingakala.mp3 | 2022-08-09 03:16 | 156K | |
![[SND]](/icons/sound2.gif) | Rafae1.mp3 | 2022-08-09 03:10 | 4.1M | |
![[SND]](/icons/sound2.gif) | Uyirini Uyire.mp3 | 2022-08-09 02:49 | 0 | |
![[SND]](/icons/sound2.gif) | CRUMBY.mp3 | 2022-08-09 02:44 | 0 | |
![[SND]](/icons/sound2.gif) | ELMANANA.mp3 | 2022-08-09 02:29 | 0 | |
![[SND]](/icons/sound2.gif) | EARFQUAKE.mp3 | 2022-08-09 02:23 | 0 | |
![[SND]](/icons/sound2.gif) | Rage Music.mp3 | 2022-08-09 02:19 | 0 | |
![[SND]](/icons/sound2.gif) | Track_002.mp3 | 2022-08-09 02:11 | 0 | |
![[SND]](/icons/sound2.gif) | Track_001.mp3 | 2022-08-09 02:09 | 0 | |
![[SND]](/icons/sound2.gif) | PaperAwaySound.mp3 | 2022-08-09 02:03 | 0 | |
![[SND]](/icons/sound2.gif) | vcy.mp3 |