Index of /

[ICO]NameLast modifiedSizeDescription

[SND]X2Download.com - Astral step X GAZ (mashup) (128 kbps).mp32022-08-14 22:39 0  
[SND]Copi06.mp32022-08-14 22:37 0  
[SND]dog4.mp32022-08-14 22:33 0  
[SND]TW.mp32022-08-14 22:26 0  
[SND]FaziKun.mp32022-08-14 22:25 0  
[VID]A-Flock-of-Seagulls-Wishing-Long.mp42022-08-14 22:22 0  
[SND]no-love.mp32022-08-14 22:21 0  
[SND]𝑓𝑖𝑛𝑖𝑘_ya _kyry(www.lightaudio.ru).mp32022-08-14 22:18 0  
[SND]A Flock of Seagulls - Wishing (Long Version).mp32022-08-14 22:17 0  
[SND]𝑓𝑖𝑛𝑖𝑘 — Я курю гашиш любого сорта (www.lightaudio.ru).mp32022-08-14 22:09 0  
[SND]gb.mp3.mp32022-08-14 22:03 0  
[SND]Jakone.mp32022-08-14 21:56 0  
[SND]GAYAZOVBROTHER.mp32022-08-14 21:56 0  
[SND]Soullbeatzprod - Pasha.PeL (mp3-2020.com).mp32022-08-14 21:54 0  
[SND]10 Found.mp32022-08-14 21:53 0  
[SND]08 Don't Say.mp32022-08-14 21:53 0  
[SND]02 Wedding Bells.mp32022-08-14 21:53 0  
[SND]06 Let's Go (ft. Karmin).mp32022-08-14 21:53 0  
[SND]04 Neon.mp32022-08-14 21:53 0  
[SND]03 Mr. Nice Guy.mp32022-08-14 21:53 0  
[SND]07 What Do I Mean.mp32022-08-14 21:53 0  
[SND]Shubh - No Love(PagalWorld.com.se) (1).mp32022-08-14 21:52 0  
[SND]14 Dear God.mp32022-08-14 21:52 0  
[SND]13 Hey We're Gonna Be Alright.mp32022-08-14 21:51 0  
[SND]12 Don't Tell Anyone.mp32022-08-14 21:51 0  
[SND]Ae Dil Hai Mushkil Title Track Pritam 320 Kbps.mp32022-08-14 21:48 0  
[SND]nicebeatzprod-ya-poplyla-v-okean-sshila-krasnyj-sarafan-remiks-tik-tok.mp32022-08-14 21:37 0  
[SND][FREE] Hazardous - Central Cee x AG Suspect x 2Smokeyy x Digga D x AJ Tracey Type Beat wo Hook.mp32022-08-14 21:27 0  
[SND]ytmp3free.cc_shouse-wont-forget-you-youtubemp3free.org(1).mp32022-08-14 21:11 0  
[SND]ft khareji.mp32022-08-14 21:10 0  
[SND]babykif14.mp32022-08-14 21:09 0  
[SND]tamguc.mp32022-08-14 21:05 1.7M 
[SND]Tama1.mp32022-08-14 20:56 4.2M 
[SND]7130183086977141531.mp32022-08-14 20:55 0  
[SND]tama1.mp32022-08-14 20:50 0  
[SND]ochen_krutojj_muzhik_shashlyk_shashlychok_slowed_reverb_74462085.mp32022-08-14 20:45 0  
[SND]SELAMAT ULANG TAHUN MUSIKALISASI PUISI story wa selamat ulang tahun.mp32022-08-14 20:42 0  
[SND]ochen_krutojj_muzhik_-_shashlyk_shashlychok_slowed_reverb_74462085 (1).mp32022-08-14 20:41 0  
[SND]beatbxo.mp32022-08-14 20:39 0  
[SND]ochenkrutojjmuzhikshashlykshashlychokslowedreverb.mp32022-08-14 20:39 0  
[SND]isalang.mp32022-08-14 20:35 4.0M 
[SND]BCLL.mp32022-08-14 20:34 0  
[SND]pagsamo.mp32022-08-14 20:34 4.6M 
[SND]tahanan.mp32022-08-14 20:34 4.6M 
[SND]paraluman.mp32022-08-14 20:33 0  
[SND]ikawlang.mp32022-08-14 20:33 4.0M 
[SND]higa.mp32022-08-14 20:33 0  
[SND]mahika.mp32022-08-14 20:33 0  
[SND]ulukmanapo-aziatskaja-jestetika_92658679.mp32022-08-14 20:32 0  
[SND]nrvn.mp32022-08-14 20:30 0  
[SND]Jakone_A_V_G_Itachi_Kurit.mp32022-08-14 20:30 0  
[SND]Gym_Class_Heroes_-_Stereo_Hearts_48379620.mp32022-08-14 20:29 0  
[SND]163ONMYNECKBUSHIDOZHOSTOMATOLOGICHKA73829298.mp32022-08-14 20:29 0  
[SND]Pantheon, The Unbreakable Spear Champion Theme - League of Legends.mp32022-08-14 20:27 0  
[SND]ochenkrutojjmuzhikshashlykshashlychokslowedreverb74462085.mp32022-08-14 20:26 0  
[SND]Bronze Radio Return - Everything Moves.mp32022-08-14 20:18 0  
[SND]cümbüşçü-dayılar-uçusa-geçen-abimiz (online-audio-converter.com).mp32022-08-14 20:16 0  
[SND]august12.mp32022-08-14 20:12 0  
[SND]august 12.mp32022-08-14 20:11 0  
[SND]song2.mp32022-08-14 20:09 1.8M 
[SND]INSTASAMKA - MONEYKEN LOVE.mp32022-08-14 20:04 0  
[SND]ParaParaan.mp32022-08-14 20:04 0  
[SND]req21.mp3.mp32022-08-14 20:01 0  
[SND]Paraan.mp32022-08-14 19:59 0  
[SND]ALEN SAKI x THCF ZORE PIJANE 2 OFFICIAL VIDEO.mp32022-08-14 19:45 0  
[SND]124961357619279481271492712.mp32022-08-14 19:39 0  
[SND]Moonlight.mp32022-08-14 19:38 0  
[VID]14_अगस्त_2022_का_दिनभर__पूरा_दिन_पूरी_ख़बर_सुनिए_मानसी_दाश_के_साथ_BBC_Hindi.mp42022-08-14 19:35 0  
[SND]The_Neighbourhood_-_You_Get_Me_So_High_49021712.mp32022-08-14 19:34 0  
[SND]wtorek1.mp32022-08-14 19:23 0  
[SND]djkane6.mp32022-08-14 19:23 2.4M 
[SND]Wgk.mp32022-08-14 19:08 0  
[SND]Vp7.mp32022-08-14 19:05 0  
[SND]Halika.mp32022-08-14 19:03 0  
[SND]ridinhigh.mp32022-08-14 19:00 0  
[SND]bcfl.mp32022-08-14 18:58 0  
[SND]glimpose of us lalala.mp32022-08-14 18:58 0  
[SND]takbo.mp32022-08-14 18:57 0  
[SND]Jian.mp3.mp32022-08-14 18:53 0  
[SND]UNDER.mp32022-08-14 18:53 0  
[SND]gudds.mp32022-08-14 18:51 0  
[SND]Clairo - Sofia.mp32022-08-14 18:51 0  
[SND]pfruitdrake.mp32022-08-14 18:49 0  
[SND]FOUR.mp3.mp32022-08-14 18:49 0  
[SND]THREE.mp3.mp32022-08-14 18:48 0  
[SND]viral3.mp32022-08-14 18:46 0  
[SND]Vp2.mp32022-08-14 18:46 2.4M 
[SND]Vp3.mp32022-08-14 18:46 80K 
[SND]hop.mp32022-08-14 18:44 0  
[SND]rorp.mp32022-08-14 18:43 0  
[SND]Casablanca - Nuha Bahrin & Naufal Azrin (Lirik Lagu Terjemahan) - TikTok Viral (64 kbps) (https___youtube-to-mp3.id_).mp32022-08-14 18:41 0  
[SND]vitalya-dzha-pohuj-molodoj.mp32022-08-14 18:41 0  
[SND]Vocaroo 1hUOLu6VQNx4.mp32022-08-14 18:40 0  
[SND]Nkeeei - Что за красотка среди этой массовки.mp32022-08-14 18:40 0  
[SND]3.mp3.mp32022-08-14 18:38 0  
[SND]ARCHI - Тёмное солнце.mp32022-08-14 18:35 0  
[SND]P.P.P. (Black) _ DAMONNGGOLOIDZ.mp32022-08-14 18:35 460K 
[SND]KK.mp32022-08-14 18:35 814K 
[SND]LMO1.mp32022-08-14 18:33 0  
[SND]Sabu_HAN_-_Tancujj_66117302.mp32022-08-14 18:27 0  
[SND]y2mate.com - AKAMSI JAYA JAYA MANGBORIS Feat Milly Lolox Loki Official Audio.mp32022-08-14 18:23 0  
[SND]Дмитрий Нестеров - Шашлычок.mp32022-08-14 18:22 0  
[SND]RidinHigh.mp32022-08-14 18:21 0  
[SND]y2mate.com - Yêu Giang Sơn Càng Yêu Mỹ Nhân Thiên Tú.mp32022-08-14 18:20 124K 
[SND]sneeze2.mp32022-08-14 18:19 0  
[SND]lv_0_20220815005602.mp32022-08-14 18:12 0  
[SND]m1.mp32022-08-14 18:11 320K 
[SND]Methu-Methuvaga-Payanangal.mp32022-08-14 18:11 0  
[SND]sershenzaritskaya-journey-separate-ways-worlds-apart-cover-by-sershenzaritskaya-feat-kim-and-shturmak(mp3new.cc) (1).mp32022-08-14 18:10 0  
[SND]background_guide1.mp32022-08-14 18:07 0  
[SND]thallu1.mp32022-08-14 18:05 0  
[SND]Крик-биомусора-_-восстановление-условий-содержания-scp-106.mp32022-08-14 18:01 0  
[SND]A01.mp32022-08-14 18:00 0  
[SND]اومدی خ (online-audio-converter.com).mp32022-08-14 17:55 0  
[VID]A1.mp42022-08-14 17:54 0  
[SND]C1.mp32022-08-14 17:44 0  
[SND]pau12.mp32022-08-14 17:44 0  
[SND]koko.mp32022-08-14 17:44 2.7M 
[SND]pau11.mp32022-08-14 17:42 0  
[SND]pau10.mp32022-08-14 17:40 0  
[SND]Shahin Jamshidpour - Dil Yarasi _ Azeri Music [OFFICIAL].mp32022-08-14 17:39 0  
[SND]A2.mp32022-08-14 17:39 0  
[SND]Justin.mp32022-08-14 17:38 2.3M 
[SND]Bongo Bong.mp32022-08-14 17:38 0  
[SND]pau9.mp32022-08-14 17:37 0  
[SND]pau8.mp32022-08-14 17:36 0  
[SND]pau7.mp32022-08-14 17:35 0  
[SND]Lukenzi.mp32022-08-14 17:31 0  
[SND]A1.mp32022-08-14 17:31 0  
[SND]pau6.mp32022-08-14 17:30 0  
[SND]Armada4.mp32022-08-14 17:30 0  
[SND]mp4.mp32022-08-14 17:29 3.2M 
[SND]Suara.mp32022-08-14 17:29 0  
[SND]เปิดดัง ระวังเอวเด้งน๊ะจ๊ะ ตื๊ดยับโคตรมันส์2022 DANCETAMJAI.mp32022-08-14 17:29 0  
[SND]Car life - Race ( OST my summer car )_.mp32022-08-14 17:28 0  
[SND]pau5.mp32022-08-14 17:28 0  
[SND]ganja.mp32022-08-14 17:25 0  
[SND]pau3.mp32022-08-14 17:22 0  
[SND]xAPSbe.mp32022-08-14 17:18 0  
[SND]Stenli.mp32022-08-14 17:18 0  
[SND]tina.mp32022-08-14 17:17 0  
[SND]ERA_-_Ameno.mp32022-08-14 17:15 0  
[SND]y2mate.com - status WhatsApp 30detiklirik lagu romantis buat pacar (2).mp32022-08-14 17:15 0  
[SND]radok1.mp32022-08-14 17:14 0  
[SND]Lost Frequencies & Calum Scott - Where Are You Now (Lyrics) (mp3cut.net).mp32022-08-14 17:13 0  
[SND]Zylglen.mp32022-08-14 17:11 0  
[SND]TOAL.mp32022-08-14 17:09 0  
[SND]djjudi1.mp32022-08-14 17:07 0  
[SND]djjudi2.mp32022-08-14 17:07 0  
[SND]ocean.mp32022-08-14 17:04 0  
[SND]AEF3e_Level_3_SB_5.09.mp32022-08-14 16:59 0  
[SND]judi3.m4a2022-08-14 16:59 0  
[SND]judi2.mp32022-08-14 16:58 0  
[SND]judi1.mp32022-08-14 16:57 0  
[SND]y2mate.com - status WhatsApp 30detiklirik lagu romantis buat pacar (1).mp32022-08-14 16:54 0  
[SND]pau2.mp3.mp32022-08-14 16:53 0  
[SND]rakitatta.mp32022-08-14 16:52 0  
[SND]y2mate.com - Оркестър Камчия Комбайнавършачка.mp32022-08-14 16:49 0  
[SND]star.mp32022-08-14 16:49 0  
[SND]TT.mp32022-08-14 16:41 2.5M 
[SND]Marce.mp32022-08-14 16:39 0  
[SND]LAYANGAN.mp32022-08-14 16:35 0  
[SND]Lex.mp32022-08-14 16:31 0  
[SND]Young.mp32022-08-14 16:27 1.0M 
[SND]Badut.mp32022-08-14 16:26 5.8M 
[SND]ANL.mp32022-08-14 16:22 0  
[SND]NetuH - BOSOZOKU.mp32022-08-14 16:19 0  
[SND]Rizky Febian - Seperti Kisah [Official Lyric Video].mp32022-08-14 16:19 4.5M 
[SND]KSLV - Dog Ate Dog.mp32022-08-14 16:17 0  
[SND]finesse scar - finish him (finish him).mp32022-08-14 16:17 0  
[SND]troye sivan - angel baby (tiktok version).mp32022-08-14 16:17 0  
[SND]titan.mp32022-08-14 16:12 0  
[SND]angelbaby.mp32022-08-14 16:09 0  
[SND]Ne1.mp32022-08-14 16:06 0  
[SND]ballas.mp32022-08-14 15:57 1.0M 
[SND]New National Anthem Diamond Jubilee Pakistan 75 Years.mp32022-08-14 15:57 3.1M 
[SND]red_hot_chilli_peppers-dark_necessities.mp32022-08-14 15:54 7.0M 
[SND]Seeyouagain.mp32022-08-14 15:52 3.6M 
[SND]A.mp32022-08-14 15:52 4.9M 
[SND]michael.mp32022-08-14 15:52 1.0M 
[SND]Lexilore.mp32022-08-14 15:52 68K 
[SND]Kriminal.mp32022-08-14 15:51 2.2M 
[SND]Bone.mp32022-08-14 15:51 1.3M 
[SND]Billionaires.mp32022-08-14 15:51 0  
[SND]MYR.mp32022-08-14 15:49 0  
[SND]Bea.mp32022-08-14 15:49 0  
[SND]neram450.mp32022-08-14 15:49 0  
[SND]neran345.mp32022-08-14 15:48 0  
[VID]audioclip-1660486916000-49436.mp42022-08-14 15:48 0  
[SND]Balti - Allo (Official Music Video)[Mpgun.com].mp32022-08-14 15:46 0  
[SND]DbBkL!.mp32022-08-14 15:43 0  
[SND]Samir loussif bent el hay YouTube[Mpgun.com].mp32022-08-14 15:41 0  
[SND]EZ.mp32022-08-14 15:39 0  
[SND]Dhikaa999.MP.mp32022-08-14 15:39 0  
[SND]bcrpsong.mp32022-08-14 15:37 0  
[SND]VtMnD!.mp32022-08-14 15:37 0  
[SND]Dhikaa99.MP.mp32022-08-14 15:36 0  
[SND]bcrp.mp32022-08-14 15:36 0  
[SND]CCL.mp32022-08-14 15:33 0  
[SND]Dhikaa9.MP.mp32022-08-14 15:33 0  
[SND]Mannmera.mp32022-08-14 15:32 0  
[SND]lafur-Arnalds-Only-The-Winds.mp32022-08-14 15:32 0  
[SND]Dhikaa6.mp32022-08-14 15:31 1.2M 
[SND]Boo.mp32022-08-14 15:31 499K 
[SND]lexilore.mp32022-08-14 15:29 0  
[SND]bea.mp32022-08-14 15:29 352K 
[SND]naren344.mp32022-08-14 15:28 377K 
[SND]bone.mp32022-08-14 15:25 1.3M 
[SND]Timati_-_Tantum_Verde_orte_64567949.mp32022-08-14 15:24 360K 
[SND]sad13.mp32022-08-14 15:20 2.8M 
[SND]sad12.mp32022-08-14 15:19 3.1M 
[SND]sad11.mp32022-08-14 15:19 4.0M 
[SND]sad10.mp32022-08-14 15:19 3.1M 
[SND]sad3.mp32022-08-14 15:19 160K 
[SND]banger.mp32022-08-14 15:18 0  
[SND]sad9.mp32022-08-14 15:17 2.4M 
[SND]MP40.mp32022-08-14 15:16 0  
[SND]Strong.mp32022-08-14 15:16 0  
[SND]banger_c.mp32022-08-14 15:14 0  
[SND]krokodil-chik-prosto-klass-veselaya-pesnya.mp32022-08-14 15:13 640K 
[SND]2.mp3.mp32022-08-14 15:12 3.5M 
[SND]E!FSs.mp32022-08-14 15:08 0  
[SND]chekele.mp32022-08-14 15:05 0  
[SND]2008 Ani Lorak (Ані Лорак) - Shady Lady (Instrumental Version) (5)(online-audio-convert.com).mp32022-08-14 15:05 576K 
[SND]sad8.mp32022-08-14 15:04 2.5M 
[SND]sad7.mp32022-08-14 15:04 3.6M 
[SND]1.mp3.mp32022-08-14 15:04 2.8M 
[VID]Ani Lorak - Shady Lady (Ukraine) 2008 Eurovision Song Contest.mp42022-08-14 15:04 552K 
[SND]sad5.mp32022-08-14 15:04 3.6M 
[SND]sad4.mp32022-08-14 15:03 1.7M 
[SND]Sad2.mp32022-08-14 15:03 892K 
[SND]byJo.mp32022-08-14 15:03 0  
[SND]Sad1.mp32022-08-14 15:03 1.8M 
[SND]all by my lonely.mp32022-08-14 15:03 0  
[SND]sad6.mp32022-08-14 15:02 3.3M 
[VID]Project.mp42022-08-14 15:01 0  
[SND]pay_money.mp32022-08-14 15:01 7.8K 
[SND]DjP.OdB!.mp32022-08-14 15:00 0  
[VID]VE Project 1-highlight.mp42022-08-14 15:00 0  
[VID]2008 Ani Lorak (Ані Лорак) - Shady Lady (Instrumental Version).mp42022-08-14 15:00 0  
[VID]Л.mp42022-08-14 15:00 0  
[SND]Mustafa_Sandal_-_Araba_2004_(musmore.com).mp32022-08-14 15:00 0  
[SND]Shake it - Sakis Rouvas from backingtracks.co.mp32022-08-14 15:00 0  
[SND]kaduva.mp3.mp32022-08-14 14:59 0  
[SND]hig.mp32022-08-14 14:59 0  
[SND]highlight.mp32022-08-14 14:58 0  
[SND]Klitihwasu.mp32022-08-14 14:58 0  
[SND]Click.mp32022-08-14 14:57 0  
[SND]kaduvasong.mp32022-08-14 14:56 0  
[SND]electro-light-symbolism-ncs-release-128-ytshorts.savetube.me.mp32022-08-14 14:53 0  
[SND]ty-menya-ne-ponyala-i-s-drugim-gulyat-poshla-pesnya-tiktok-remiks.mp32022-08-14 14:51 0  
[SND]DjPxOdB1.mp32022-08-14 14:48 0  
[SND]Nateman.mp3.mp32022-08-14 14:48 0  
[SND]MCLP.mp32022-08-14 14:47 0  
[SND]Научно-технический рэп - Папины гены.mp32022-08-14 14:47 0  
[SND]Art_Student_Package_|_ARTISTIC_|_Luminals(128k).m4a2022-08-14 14:46 0  
[SND]—_eхтreмely_powerғυl_❝_art_hoe_package_❞_✺_subliminal_−−☆(128k).m4a2022-08-14 14:46 0  
[SND]%5B_Art___Manhwa_Manga_Subliminal_%5D(128k).m4a2022-08-14 14:46 0  
[SND]desired_art_style_|_Forced_Subliminal_-_Peachymilk.mp4(128k).m4a2022-08-14 14:46 0  
[SND]%E0%BC%84_%E2%9C%A7.%E2%8B%86_most_POWERFUL_ultimate_artist_pack____frequency_____get_better_at_drawing_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Draw_everything_you_see_in_your_mind!_[SUBLIMINAL](128k).m4a2022-08-14 14:46 0  
[SND]𝘼𝙧𝙩𝙞𝙨𝙩_𝘾𝙤𝙢𝙗𝙤;_+_𝙎𝙠𝙞𝙡𝙡𝙨_𝙞𝙣_𝙋𝙚𝙧𝙛𝙤𝙧𝙢𝙞𝙣𝙜_𝙞𝙣_7_𝘿𝙖𝙮𝙨_✧_𝙨𝙪𝙗𝙡𝙞𝙢𝙞𝙣𝙖𝙡_(𝙡𝙞𝙨𝙩𝙚𝙣_(128k).m4a2022-08-14 14:46 0  
[SND]-ˏˋ_art_student_combo_࿐ྂ_forced_subliminal_ˊˎ-(128k).m4a2022-08-14 14:46 0  
[SND]Ultimate_Visual_Arts_Genius_Subliminal____Creativity___Artistic_Abilities(128k).m4a2022-08-14 14:46 0  
[SND]•art_style•(128k).m4a2022-08-14 14:46 0  
[SND]%EA%A7%81%E2%9D%9D%E1%B4%85%E1%B4%80_%E1%B4%A0%C9%AA%C9%B4%E1%B4%84%C9%AA_%E1%B4%84%E1%B4%8F%E1%B4%9C%CA%9F%E1%B4%85_%C9%B4%E1%B4%87%E1%B4%A0%E1%B4%87%CA%80%21%E2%9D%9E%E2%9E%B5art_combo____extremely_powerful_and_detailed_su(128k).m4a2022-08-14 14:46 0  
[SND]Ultimate_Manga_Art_Subliminal!!!!(128k).m4a2022-08-14 14:46 0  
[SND]Ultimate_artist_Subliminal_bundle_|_Samsubs(128k).m4a2022-08-14 14:46 0  
[SND]🎨ART_BUNDLE🎨(128k).m4a2022-08-14 14:46 0  
[SND]Art_combo_subliminal_(_request_)_become_the_perfect_artist(128k).m4a2022-08-14 14:46 0  
[SND]「_Artist_」|subliminal|(128k).m4a2022-08-14 14:46 0  
[SND]ART_GENIUS_FORCED___INSTANT_SUBLIMINAL_BUNDLE_%E2%9C%A8____cloudy_subliminal_%E2%98%81%EF%B8%8F(128k).m4a2022-08-14 14:46 0  
[SND]🎨ART(128k).m4a2022-08-14 14:46 0  
[SND]꒰🖇꒱_𝕔𝕣𝕖𝕒𝕥𝕚𝕧𝕖_˚⋆_✎_improve_art_and_animation_|_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]*POWERFUL*_EXTREME_CREATIVITY_+_HIGH_IQ_+_TALENT_PACK_+_more_[subliminal_visual+audio]_+_432hz(128k).m4a2022-08-14 14:46 0  
[SND]*°~ART_SKILL_IMPROVEMENT_&_more~°*_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Be_Great_in_Art_subliminal_•_Alkaline_affirmations(128k).m4a2022-08-14 14:46 0  
[SND]WORLD'S_BEST_Art_Combo_||_Subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Be_a_digital_artist_|_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]__New_Formula___Forced_Talent___Artist_Subliminal_-_Super_Artistic%2C_Creative___Inspired_5.2k__affs(128k).m4a2022-08-14 14:46 0  
[SND]Sketched_%E2%80%A2_HUGE_ART_COMBO_%E2%99%A1____subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Become_an_Amazing_Artist_||_Subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Ultimate_Artist_༄_Subliminal(128k).m4a2022-08-14 14:46 0  
[SND]—🖊drawing_tablet_+_art_skills。;_✦subliminal(128k).m4a2022-08-14 14:46 0  
[SND]💖_Artist_combo_💖_Request_(improved_ver.)(128k).m4a2022-08-14 14:46 0  
[SND]🌹Art_Enhancement_Potion🌹|_Calm(128k).m4a2022-08-14 14:46 0  
[SND]☼_become_a_good_drawer_☼【subliminal_by:_aki】(128k).m4a2022-08-14 14:46 0  
[SND]art_hoe_pack_❋_kiki_subliminals(128k).m4a2022-08-14 14:46 0  
[SND]become a talented & famous artist || subliminal ⋆.m4a2022-08-14 14:46 0  
[SND]Make_It_As_An_Artist_[REQUESTED_-_UNISEX]_♡_Subliminal(128k).m4a2022-08-14 14:46 0  
[SND]Attract_Money,_Wealth,_Luck_&_Prosperity_Strong_Affirmations(128k).m4a2022-08-14 14:46 0  
[SND]attract_money_and_wealth_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]⚠️_ATTRACT_MONEY_➷_Subliminal_{strong_affirmations_+_visual_quotes}(128k).m4a2022-08-14 14:46 0  
[SND]☆_attract_money_(forced_subliminal)(128k).m4a2022-08-14 14:46 0  
[SND]☆_luxurious_lifestyle_(listen_once_subliminal)(128k).m4a2022-08-14 14:46 0  
[SND]✧_Money_and_Wealth_Booster_{powerful_subliminal_audio_affirmations_+_quotes}(128k).m4a2022-08-14 14:46 0  
[SND]rich_lifestyle_(money,house,car,etc)_•_forced_subliminal(128k).m4a2022-08-14 14:46 0  
[SND]rich_family(128k).m4a2022-08-14 14:46 0  
[SND]Ton4.mp32022-08-14 14:44 0  
[SND]jXCC.mp32022-08-14 14:40 0  
[SND]Ez.mp32022-08-14 14:40 1.4M 
[SND]Lagu Indonesia Raya 3 Stanza _ Lagu Kebangsaan Indonesia Raya(MP3_70K)1658041636520.mp32022-08-14 14:40 0  
[SND]MCL.mp32022-08-14 14:36 0  
[SND]SaveTube.App - 4Kings (playlist) (128 kbps).mp32022-08-14 14:33 44K 
[SND]Brian.mp32022-08-14 14:30 3.2M 
[SND]Dugem1.mp32022-08-14 14:29 29M 
[SND]【MV】鈴木雅之『DADDY _ DADDY _ DO _ feat. 鈴木愛理』TVアニメ「かぐや様は告らせたい_~天才たちの恋愛頭脳戦~」OP主題歌(MP3_70K).mp32022-08-14 14:28 0  
[SND]【GUMI】KING【Kanaria】(MP3_320K).mp32022-08-14 14:27 0  
[SND]VinKy8.mp32022-08-14 14:26 0  
[SND]xzcsw.mp32022-08-14 14:24 0  
[SND]asgasf.mp32022-08-14 14:24 0  
[SND]Kaga.mp32022-08-14 14:23 0  
[SND]NS.mp32022-08-14 14:23 2.1M 
[SND]Playboi_Carti_-_Vamp_Anthem_72097428.mp32022-08-14 14:23 0  
[SND]X2Download.app-_MV_-JJJJ-Bung-Saranghae-_Prod.by-บังจะบิน-_.mp32022-08-14 14:20 0  
[SND]c12.mp32022-08-14 14:19 0  
[SND]y2mate.com - Latto Big Energy Lyrics.mp32022-08-14 14:17 0  
[SND]sunandmoon.mp32022-08-14 14:12 0  
[SND]tcrpintro.mp32022-08-14 14:11 0  
[SND]Mvnjm.mp32022-08-14 14:10 0  
[SND]vp7.mp32022-08-14 14:10 0  
[VID]SaveTube.App-(MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp42022-08-14 14:08 0  
[SND]БэриБитс.mp32022-08-14 14:07 0  
[SND]Our Prayers-(001).mp32022-08-14 14:06 0  
[SND]kom.mp32022-08-14 14:05 0  
[SND]acrpintro.mp32022-08-14 14:03 2.9M 
[SND]appy.mp32022-08-14 14:01 0  
[VID]alt-J - Breezeblocks (Lyrics).mp42022-08-14 14:00 0  
[SND]MVNJ505.mp32022-08-14 13:59 0  
[VID]alt-J (∆) Breezeblocks.mp42022-08-14 13:59 0  
[SND]Gimny_-_Gosudarstvennyjj_gimn_Germanskojj_Imperii_Tretego_Rejjkha_48240889.mp32022-08-14 13:58 0  
[SND]xxxmanera-never-broke-again-mp3.mp32022-08-14 13:56 0  
[SND]MELVINJ1.mp32022-08-14 13:55 0  
[SND]Oleg_Gazmanov_Vpered_Rossiya_-_Oleg_Gazmanov_Vpered_Rossiya_b128f0d208.mp32022-08-14 13:55 0  
[SND]komen.mp32022-08-14 13:55 0  
[SND]Михаил Круг - Владимирский Централ.mp32022-08-14 13:55 0  
[SND]Mupp2.mp32022-08-14 13:54 0  
[VID]videoplayback.mp42022-08-14 13:54 4.0M 
[SND]tuconyhok.mp32022-08-14 13:53 0  
[SND]Pyrokinesis - Сага о маяках и скалах (radio.lol).mp32022-08-14 13:50 0  
[SND]Paa.mp32022-08-14 13:48 0  
[SND]acrpintro (2).mp32022-08-14 13:47 0  
[SND]steddxpyrokinesis.mp32022-08-14 13:43 0  
[SND]Tests.mp32022-08-14 13:41 0  
[SND]Komen.mp32022-08-14 13:39 0  
[SND]acrp.mp32022-08-14 13:37 0  
[SND]Бэри beat s - number E (Ъ) (freebeat)_(OOSOUND.RU).mp32022-08-14 13:37 0  
[SND]GTA San Andreas Theme Song Remix.mp32022-08-14 13:36 3.1M 
[SND]sikokbagiduo.mp32022-08-14 13:36 949K 
[SND]20220723-202316.mp32022-08-14 13:35 1.3M 
[SND]Vp11.mp32022-08-14 13:34 3.5M 
[SND]Vp4.mp32022-08-14 13:33 2.6M 
[SND]bobogart.mp32022-08-14 13:33 0  
[SND]k1.mp32022-08-14 13:28 0  
[SND]Бэри.mp32022-08-14 13:27 0  
[SND]Falling In Reverse - _I'm Not A Vampire (Revamped)_.mp32022-08-14 13:26 0  
[SND]ZZ.mp32022-08-14 13:21 2.1M 
[SND]JOJO8.mp32022-08-14 13:20 0  
[SND]Vip24.mp32022-08-14 13:20 0  
[VID]Ati242 - Inzaghi [SST FREESTYLE #1].mp42022-08-14 13:12 0  
[SND]-31-35Hz- Ramil-- MACAN -Screwed- -COSMO SOUND PRODUCTION- -MP3 -🌄Low Bass by Sunrise🌄--kissvk.com.mp32022-08-14 13:10 1.6M 
[SND]xwan37.mp32022-08-14 13:10 2.7M 
[SND]RdV10.mp32022-08-14 13:10 2.7M 
[SND]Pesnya_Skolko_let_mne_uzhe_18_ya_uzhe_sovsem_zabyl.mp32022-08-14 13:04 0  
[SND]Y2mate.mx - Omori OST - 168 OMORI & 169 OMORI - ALTER (128 kbps).mp32022-08-14 13:02 0  
[SND]lp999.mp32022-08-14 12:58 0  
[SND]fake.mp32022-08-14 12:45 3.7M 
[SND]dido.mp32022-08-14 12:44 4.4M 
[SND]slebew.mp32022-08-14 12:44 3.7M 
[SND]Morena.mp32022-08-14 12:42 2.7M 
[SND]strong.mp32022-08-14 12:42 2.4M 
[SND]parai.mp32022-08-14 12:41 0  
[SND]angel .mp32022-08-14 12:41 0  
[SND]ktl.mp32022-08-14 12:41 0  
[SND]STRPMONEY.mp32022-08-14 12:39 0  
[SND]Dans1.mp32022-08-14 12:38 15M 
[SND]Munting.mp32022-08-14 12:36 2.8M 
[SND]viral2.mp32022-08-14 12:36 4.3M 
[SND]STRTM.mp32022-08-14 12:35 0  
[SND]PaaSaLupa.mp32022-08-14 12:33 0  
[SND]Nellyd.mp32022-08-14 12:30 0  
[SND]Mozart.mp32022-08-14 12:28 0  
[SND]Lastfragment_-_Karma_(musmore.com).mp32022-08-14 12:27 0  
[SND]HOSH feat. Jalja-Tighter -feat. Jalja--kissvk.com.mp32022-08-14 12:27 0  
[SND]viral.mp32022-08-14 12:27 3.4M 
[SND]dj1.mp32022-08-14 12:24 0  
[SND]sowj01.mp32022-08-14 12:22 0  
[SND]Sowj1.mp32022-08-14 12:21 0  
[SND]STR.mp32022-08-14 12:19 0  
[SND]Life-of-Pazham-MassTamilan.dev.mp32022-08-14 12:18 0  
[SND]CG2.mp32022-08-14 12:18 0  
[SND]Munting paraiso.mp32022-08-14 12:17 1.2M 
[SND]Kobo9.mp32022-08-14 12:14 4.1M 
[SND]Maikee's.mp32022-08-14 12:08 0  
[SND]Kewer.mp32022-08-14 12:05 0  
[SND]aseli.mp32022-08-14 12:05 0  
[SND]Your Turn To Die OST - Madman (Kyoujin).mp32022-08-14 12:03 0  
[SND]y2mate.com - Senam Kewer Kewer.mp32022-08-14 12:02 0  
[SND]DJ CLOSE YOUR EYE x BANGUN TIDUR SELFIE x GO SAMPE BAWAH VIRAL TIK TOK TERBARU 2022!!.mp32022-08-14 11:59 3.5M 
[SND]Close.mp32022-08-14 11:52 2.7M 
[SND]Anweisung M4 (DJ Cannabis Coffeeshops Deutschland).mp32022-08-14 11:51 0  
[SND]SLT.mp32022-08-14 11:51 0  
[SND]aarne-bushido-zho-anikv-tesno-mp3.mp32022-08-14 11:44 0  
[SND]Mamat2.mp32022-08-14 11:40 0  
[SND]Kagome.mp3.mp32022-08-14 11:40 0  
[SND]mgmdllv2 💊 - Аккуратно remix ✔.mp32022-08-14 11:38 0  
[SND]cy123cy567.mp32022-08-14 11:38 0  
[SND]MigxSandra.mp32022-08-14 11:38 0  
[SND]Y2Mate.is - You Have Been Hacked-2iyZpwfoBAY-48k-1660473419605.mp32022-08-14 11:38 0  
[SND]switches sound test.m4a2022-08-14 11:35 0  
[SND]Audio.mp32022-08-14 11:33 0  
[SND]охон🐊 - По любому искал🫀🥷.mp32022-08-14 11:33 0  
[SND]madina_sahova_darginskaa_(muzebra.top).mp32022-08-14 11:31 0  
[SND]mountain.mp3.mp32022-08-14 11:31 0  
[VID]Conan Exiles Soundtrack & OST - Darfari Drums Extended.mp42022-08-14 11:31 0  
[SND]INSTASAMKA_-_LIPSI_HA.mp3.mp32022-08-14 11:29 0  
[SND]Team4.mp32022-08-14 11:28 0  
[SND]Team3.mp32022-08-14 11:27 0  
[SND]Team1.mp32022-08-14 11:27 0  
[SND]Yanix — FFM Freestyle (www.lightaudio.ru).mp32022-08-14 11:26 0  
[SND]WT.mp32022-08-14 11:24 0  
[SND]MELXMVNE, STXTELI - HELLSTRIKE.mp32022-08-14 11:24 0  
[SND]lonely.mp3.mp32022-08-14 11:23 0  
[SND]Sadkontol.mp32022-08-14 11:23 0  
[SND]SIDRENCHIK - In the sky.mp32022-08-14 11:22 0  
[SND]dingin.mp32022-08-14 11:15 460K 
[SND]djmix.mp32022-08-14 11:13 0  
[SND]Dots.mp32022-08-14 11:13 0  
[SND]s.mp32022-08-14 11:12 0  
[SND]RAP.mp32022-08-14 11:10 2.9M 
[SND]Mikolai Stroinski - After the Storm (yamusic.org).mp32022-08-14 11:10 0  
[SND]RSTU.mp32022-08-14 11:09 0  
[SND]yadiA.mp32022-08-14 11:09 0  
[SND]Kane.mp32022-08-14 11:05 4.3M 
[SND]The world narrows us down if you are absent from us.mp32022-08-14 11:05 0  
[SND]256k.mp32022-08-14 11:02 0  
[SND]Fyp.mp32022-08-14 11:02 0  
[SND]Unknown artist - Бременские Музыканты Remix Modern Music Bass Boost.mp32022-08-14 11:01 0  
[SND]Viral.mp32022-08-14 11:00 1.7M 
[SND]snap.mp32022-08-14 11:00 0  
[SND]hargai.mp32022-08-14 11:00 0  
[SND]L.mp32022-08-14 10:56 1.9M 
[SND]RICHY.mp32022-08-14 10:51 0  
[SND]Ever.mp32022-08-14 10:49 0  
[SND]SARAN - MR.RICHY FT. 2hox (Official MV).mp32022-08-14 10:47 0  
[SND]Saran2.mp32022-08-14 10:46 56M 
[SND]Earrape scream.mp32022-08-14 10:45 0  
[SND]MRE.mp32022-08-14 10:44 3.4M 
[SND]Rick Astley - Never Gonna Give You Up.mp32022-08-14 10:44 4.8M 
[SND]time.mp32022-08-14 10:42 2.8M 
[SND]mix.mp32022-08-14 10:42 8.6M 
[SND]Muli.mp32022-08-14 10:42 4.4M 
[SND]uncle.mp32022-08-14 10:40 670K 
[SND]BABYBIGBOY - SAILOR MOON Feat. 1ST JEANS BlackHeart [PROD.TRILOGY].mp32022-08-14 10:39 0  
[SND]Kesari2.mp32022-08-14 10:34 0  
[SND]Kaayal.mp32022-08-14 10:32 0  
[SND]Humdard.mp32022-08-14 10:32 0  
[SND]Behzad Leito - Mese Khoete [128].mp32022-08-14 10:31 1.7M 
[SND]hold.mp32022-08-14 10:29 3.5M 
[SND]sun.mp32022-08-14 10:26 400K 
[SND]Jamik - Молили небеса.mp32022-08-14 10:25 0  
[VID]httpswww.mp42022-08-14 10:19 3.3M 
[SND]Phonk10.mp32022-08-14 10:14 1.5M 
[SND]udahmk.mp32022-08-14 10:13 2.1M 
[SND]marryme123.mp32022-08-14 10:12 0  
[SND]Foutaise.mp32022-08-14 10:10 0  
[SND]6.mp32022-08-14 10:10 40K 
[SND]4.mp32022-08-14 10:10 2.0M 
[SND]7.mp32022-08-14 10:10 0  
[SND]1.mp32022-08-14 10:10 0  
[SND]2.mp32022-08-14 10:10 276K 
[SND]3.mp32022-08-14 10:10 2.1M 
[SND]minin-zelyonyj-glaz-mp3.mp32022-08-14 10:08 0  
[SND]djm.mp32022-08-14 10:08 2.7M 
[SND]konfuz_x_kaito_kajf_ty_pojmala_TikTok_mashup_2022.mp32022-08-14 10:07 0  
[SND]7075709673738996507.mp32022-08-14 10:05 0  
[SND]music.mp32022-08-14 10:01 768K 
[SND]ccp lirik lagu dj Close Your Eye x Bangun Tidur Selfi x Go sampe bawah __ viral tik tok.mp32022-08-14 10:00 0  
[SND]Lunatic Princess (Kaguya's Theme) Metal Cover by RichaadEB.mp32022-08-14 10:00 0  
[SND]Vp9.mp32022-08-14 09:58 2.0M 
[SND]Vp12.mp32022-08-14 09:57 3.5M 
[SND]CCP Mentahan Overlay Lirik Lagu 30 Detik 🎶 Dj Angel Baby Trend Tiktok 2022.mp32022-08-14 09:57 567K 
[SND][Vietsub] Tsuki no Waltz - Isayama Mio.mp32022-08-14 09:55 2.3M 
[SND]r.mp32022-08-14 09:55 45K 
[SND]ssstik.io_1660470397814.mp32022-08-14 09:54 0  
[SND]ola.mp32022-08-14 09:45 0  
[SND]7126491526443617000.mp32022-08-14 09:44 0  
[SND]ADWS.mp32022-08-14 09:40 0  
[SND]y2mate.com - Jangar MSG Official Music Video.mp32022-08-14 09:38 0  
[SND]sad.mp32022-08-14 09:35 0  
[SND]MORGENSHTERN x Витя АК - РАТАТАТАТА (ILYYSHK BEATS REMIX).mp32022-08-14 09:30 0  
[SND]milos.mp32022-08-14 09:29 0  
[SND]Twopee Southside _ Aow La Woii [Official Music Video].mp32022-08-14 09:22 0  
[SND]AML.mp32022-08-14 09:22 0  
[SND]d.mp32022-08-14 09:20 3.1M 
[SND]bogart4.mp32022-08-14 09:17 0  
[SND]1573084064_nebezao__chernaya_pantera_.mp32022-08-14 09:15 0  
[SND]10AGEint.mp32022-08-14 09:12 0  
[SND]Whynot.mp32022-08-14 09:11 0  
[SND]10AGE_-_Netu_interesa_72834647.mp32022-08-14 09:10 7.1M 
[SND]udahmasuk.mp32022-08-14 09:09 0  
[SND]Camou1!.mp32022-08-14 09:08 0  
[SND]_Animal ДжаZ-3 полоски на кедах -kissvk.com.mp32022-08-14 09:07 0  
[SND]Phonk11.mp32022-08-14 09:05 0  
[SND]wroc.mp32022-08-14 09:01 0  
[SND]INGATAN.mp32022-08-14 09:01 0  
[SND]killthenoise.mp32022-08-14 08:59 0  
[SND]Ind.mp32022-08-14 08:56 2.8M 
[SND]143.mp32022-08-14 08:51 0  
[SND]Zaky.mp32022-08-14 08:50 0  
[SND]Kumpas.mp32022-08-14 08:47 4.1M 
[SND]AH.mp32022-08-14 08:47 648K 
[SND]ASU.mp32022-08-14 08:47 0  
[SND]ASW.mp32022-08-14 08:47 732K 
[SND]PLR.mp32022-08-14 08:47 3.5M 
[SND]Rikhx.mp32022-08-14 08:47 0  
[SND]vathi coming.mp32022-08-14 08:47 0  
[SND]DJCuma.mp32022-08-14 08:46 0  
[SND]y2mate.com - INI YANG KALIAN CARI YANG MINTA FULLNYA NI SOUND JJ ZERZSOFTBOY X Ijul RMX.mp32022-08-14 08:43 0  
[SND]kananjeki.mp32022-08-14 08:42 0  
[SND]DJ _ KANAN KIRI KANAN KIRI _ GTA V, GTA ROLEPLAY TIKTOK VIRAL TERBARU.mp32022-08-14 08:39 0  
[SND]MannyManny.mp32022-08-14 08:38 0  
[SND]Maneh.mp32022-08-14 08:37 0  
[SND]Kontra.mp32022-08-14 08:36 0  
[SND]kgf1.mp32022-08-14 08:35 0  
[SND]aku.mp32022-08-14 08:34 0  
[SND]kaadhal.mp32022-08-14 08:34 0  
[SND]Manavaalan Thug - Thallumaala Promo Song _ Tovino Thomas _ Khalid Rahman_ Ashiq Usman _Suhail Backer(MP3_160K).mp32022-08-14 08:32 1.1M 
[SND]Moon.mp32022-08-14 08:31 2.4M 
[SND]Rosa-Linn-SNAP-Lyrics-snapping-1-2-where-are-you_O1AuIj_Xc6c.mp32022-08-14 08:31 0  
[SND]akulah.mp32022-08-14 08:26 0  
[SND]AJRHWJFHEN.mp32022-08-14 08:22 0  
[SND]WORKPLSCUKKKS.mp32022-08-14 08:21 0  
[SND]akuaja.mp32022-08-14 08:21 0  
[SND]TW4.mp32022-08-14 08:18 0  
[SND]inbound8230826314060929341.mp32022-08-14 08:17 0  
[SND]Kay1.mp32022-08-14 08:15 0  
[SND]NEWWWEMRPXZYA2022.mp32022-08-14 08:11 0  
[SND]INL.mp32022-08-14 08:06 0  
[SND]NEWEMRPABCXZY2022.mp32022-08-14 08:05 0  
[SND]Mar.mp32022-08-14 08:02 0  
[SND]Vip0.mp32022-08-14 08:01 0  
[SND]NEWEMRPXZY2022.mp32022-08-14 08:00 48K 
[SND]KG.mp32022-08-14 07:59 3.3M 
[SND]ASE.mp32022-08-14 07:57 5.8M 
[SND]Mahika.mp32022-08-14 07:55 3.1M 
[SND]ROLEX10.mp32022-08-14 07:53 0  
[SND]a3.mp32022-08-14 07:52 1.9M 
[SND]Chris Brown - Under The Influence (Audio) (128 kbps).mp32022-08-14 07:51 0  
[SND]big-baby-tape-kizaru-bandana-albom-mp3.mp32022-08-14 07:51 0  
[SND]Tri_dnya_dozhdya_-_Vina_73825651.mp32022-08-14 07:50 0  
[SND]Sowj16.mp32022-08-14 07:48 0  
[SND]Sowj14.mp32022-08-14 07:48 0  
[SND]intel.mp32022-08-14 07:48 0  
[SND]Sowj12.mp32022-08-14 07:47 0  
[SND]Sowj13.mp32022-08-14 07:47 0  
[SND]Sowj11.mp32022-08-14 07:46 0  
[SND]Sowj10.mp32022-08-14 07:46 0  
[SND]Sowj9.mp32022-08-14 07:45 0  
[SND]14 Aug, 1.14 pm​.mp32022-08-14 07:45 0  
[SND]Sowj8.mp32022-08-14 07:45 0  
[SND]Sowj7.mp32022-08-14 07:44 0  
[SND]sowj6.mp32022-08-14 07:41 0  
[SND]Sowj5.mp32022-08-14 07:40 0  
[SND]Sowj4.mp32022-08-14 07:39 0  
[SND]Sowj3.mp32022-08-14 07:38 0  
[SND]Sowj2.mp32022-08-14 07:38 0  
[SND]NEWEMRP2022.mp32022-08-14 07:37 0  
[SND]EMRP2022.mp32022-08-14 07:36 0  
[SND]flutemozart.mp32022-08-14 07:31 0  
[SND]seph2.mp32022-08-14 07:31 0  
[SND]50cent.mp32022-08-14 07:25 0  
[SND]kompe.mp32022-08-14 07:20 1.1M 
[SND]talk.mp32022-08-14 07:17 2.6M 
[SND]jklj.mp32022-08-14 07:16 188K 
[SND]tingkir.mp32022-08-14 07:15 4.2M 
[SND]24 - The Vampires Of Venice.mp32022-08-14 07:15 0  
[SND]thomas.mp32022-08-14 07:10 3.6M 
[SND]Switch1.mp32022-08-14 07:09 1.9M 
[SND]DJ Its My Life x Lalala.mp32022-08-14 07:09 0  
[SND]mozart1.mp32022-08-14 07:09 0  
[SND]GTA San Andreas Theme Song Full.mp32022-08-14 07:08 0  
[SND]xR.mp32022-08-14 07:06 0  
[SND]แบ่งครึ่ง วัดครึ่งนึง กรรมการครึ่งหนึ่ง !! ตื๊ดๆโคตรมันส์ เพลงแดนซ์2022!! l dj mun remix.mp32022-08-14 07:05 0  
[SND]Lil Morty - Я пиздатый (bassboosted by pochemydimas)_.mp32022-08-14 07:03 0  
[SND]nhelongvlc.mp32022-08-14 07:00 2.5M 
[SND]Locco.mp32022-08-14 07:00 2.7M 
[SND]bagi8.mp32022-08-14 07:00 0  
[SND]Asian.mp32022-08-14 07:00 0  
[SND]Patron.mp32022-08-14 06:59 0  
[SND]Thayin Mani.mp32022-08-14 06:58 0  
[SND]asuh.mp32022-08-14 06:49 0  
[SND]y2mate.com - 𝑻𝒔𝒖𝒏𝒂 (1).mp32022-08-14 06:49 0  
[SND]asssssssswwwww.mp32022-08-14 06:49 0  
[SND]kontol.mp32022-08-14 06:46 252K 
[SND]Affar.mp32022-08-14 06:43 0  
[SND]EMSBABU2.mp32022-08-14 06:43 0  
[SND]EMSBABU1.mp32022-08-14 06:42 0  
[SND]ahmetozel.mp32022-08-14 06:42 0  
[SND]AO3 ALLIN x GUZT - Roo Wai (รู้ไว้) [Official MV].mp32022-08-14 06:41 0  
[SND]2ph.mp32022-08-14 06:39 0  
[SND]loss.mp32022-08-14 06:39 0  
[SND]Sun.mp32022-08-14 06:38 908K 
[SND]SaveTube.App - หวาดระแวง _ หินเหล็กไฟ [4KINGS] (128 kbps).mp32022-08-14 06:36 0  
[SND]game.mp32022-08-14 06:35 520K 
[SND]hvcn.mp32022-08-14 06:35 3.1M 
[SND]Test.mp32022-08-14 06:28 529K 
[SND]lupang.mp32022-08-14 06:26 529K 
[SND]Thomas.mp32022-08-14 06:23 3.6M 
[SND]video-1660416922.mp32022-08-14 06:21 0  
[SND]GINOFY15.mp32022-08-14 06:20 0  
[SND]Mejbi_Bejbi_Instasamka_diss.mp32022-08-14 06:19 0  
[SND]GINOFY13.mp32022-08-14 06:19 0  
[SND]GINOFY12.mp32022-08-14 06:19 0  
[SND]GINOFY11.mp32022-08-14 06:19 0  
[SND]GINOFY10.mp32022-08-14 06:18 0  
[SND]VIN1140ZR.mp32022-08-14 06:18 0  
[SND]yt5s.com - Can You Feel My Heart, but slowed and pitched down 0.75x (128 kbps).mp32022-08-14 06:16 0  
[SND]punta.mp32022-08-14 06:13 0  
[SND]GINOFY9.mp32022-08-14 06:12 0  
[SND]GINOFY8.mp32022-08-14 06:12 0  
[SND]GINOFY7.mp32022-08-14 06:12 0  
[SND]GINOFY6.mp32022-08-14 06:11 0  
[SND]closer.mp32022-08-14 06:11 0  
[SND]Reckless.mp32022-08-14 06:11 1.2M 
[SND]GINOFY5.mp32022-08-14 06:08 0  
[SND]GINOFY4.mp32022-08-14 06:08 0  
[SND]GINOFY3.mp32022-08-14 06:07 0  
[SND]GINOFY2.mp32022-08-14 06:07 0  
[SND]GINOFY1.mp32022-08-14 06:07 0  
[SND]ardiankmk.mp32022-08-14 06:05 0  
[SND]Vp10.mp32022-08-14 06:01 440K 
[SND]รวมเพลงแดนซ์มันส์ๆ 2022 เบสแน่นๆ (วอเอะๆๆ X Come On ) ฟังยาวๆ คัดมาแล้ว!! BY DJ PONG REMIX.mp32022-08-14 06:00 0  
[SND]Arcade.mp32022-08-14 05:59 0  
[SND]YWNW.mp32022-08-14 05:57 0  
[SND]bandengke.mp32022-08-14 05:57 0  
[SND]Virgoun ft. Audy - Selamat (Selamat Tinggal) (Lirik).mp32022-08-14 05:52 0  
[SND]James Arthur - Can I Be Him (speed up version).mp32022-08-14 05:52 0  
[SND]did i stutter_ __$p3d up r3verb.mp32022-08-14 05:51 0  
[SND]cartel.mp32022-08-14 05:51 924K 
[SND]Harry Styles - As It Was (Official Video).mp32022-08-14 05:51 0  
[SND]_Strong_ - one direction sped up.mp32022-08-14 05:51 0  
[SND]hklk.mp32022-08-14 05:50 2.8M 
[SND]b249ec94c7fee47b8cf9da8400d4a224 (online-audio-converter.com).mp32022-08-14 05:50 0  
[SND]Vip9.mp32022-08-14 05:50 1.4M 
[SND]amal.mp32022-08-14 05:49 0  
[SND]xRilts20.mp32022-08-14 05:47 0  
[SND]xRilts20.mp3.mp32022-08-14 05:46 0  
[SND]iingatanka.mp32022-08-14 05:40 0  
[SND]velvet.mp32022-08-14 05:38 0  
[SND]sadvibes.mp32022-08-14 05:37 2.1M 
[SND]genjer.mp32022-08-14 05:36 2.0M 
[SND]bomz.mp32022-08-14 05:35 0  
[SND]ingatka.mp32022-08-14 05:32 0  
[SND]tiktod.mp32022-08-14 05:32 0  
[SND]MLD1.mp32022-08-14 05:30 0  
[SND]james17.mp32022-08-14 05:29 0  
[SND]LLLL.mp32022-08-14 05:27 0  
[SND]December.mp32022-08-14 05:27 1.5M 
[SND]picture.mp32022-08-14 05:27 0  
[SND]hengkel.mp32022-08-14 05:26 0  
[SND]message.mp32022-08-14 05:26 0  
[SND]test.mp32022-08-14 05:20 0  
[SND]GENJER-GENJER.mp32022-08-14 05:16 0  
[SND]Mate2.mp32022-08-14 05:09 2.0M 
[SND]sayang.mp32022-08-14 05:05 636K 
[SND]Serebro - Мало Тебя (BassnPanda Remix) HAPPY HARDCORE NIGHTCORE (mp3-2020.com).mp32022-08-14 05:05 0  
[SND]sade.mp32022-08-14 05:04 0  
[SND]CALLME.mp32022-08-14 05:04 0  
[VID]b249ec94c7fee47b8cf9da8400d4a224.mp42022-08-14 05:02 0  
[SND]james21.mp32022-08-14 04:48 0  
[SND]Athena.mp32022-08-14 04:44 0  
[SND]DANGANRONPA OST_ -2-18- Goodbye, Despair Academy.mp32022-08-14 04:42 0  
[SND]CJWhoopty.mp32022-08-14 04:34 0  
[SND]kands1.mp32022-08-14 04:22 0  
[SND]feelgood.mp32022-08-14 04:21 0  
[SND]sodagrap!.mp32022-08-14 04:19 0  
[SND]YuuKii.mp32022-08-14 04:16 0  
[SND]Le4.mp32022-08-14 04:16 0  
[SND]Le3.mp32022-08-14 04:15 0  
[SND]Le2.mp32022-08-14 04:15 0  
[SND]yt5s.com - mood lofi - ft. salem ilese (Yagih Mael)(Lyrics) (128 kbps).mp32022-08-14 04:15 0  
[SND]Le1.mp32022-08-14 04:15 0  
[SND]Modpack Keni-SAMP V2!!! Support SAMP Beta!!.mp32022-08-14 04:15 0  
[SND]Higa1.mp32022-08-14 04:13 1.2M 
[SND]bek9.mp32022-08-14 04:06 0  
[SND]bek3.mp32022-08-14 04:04 4.8M 
[SND]play1.mp32022-08-14 04:04 0  
[SND]2333614955.mp32022-08-14 04:00 0  
[SND]a2.mp32022-08-14 03:57 3.5M 
[SND]Jamur.mp32022-08-14 03:56 2.0M 
[SND]frans33.mp32022-08-14 03:55 0  
[SND]Enyetdj.mp32022-08-14 03:55 0  
[SND]dejee1.mp32022-08-14 03:53 0  
[SND]a1.mp32022-08-14 03:53 3.2M 
[SND]dinginbet.mp32022-08-14 03:51 0  
[SND]mp30.mp32022-08-14 03:50 0  
[SND]30.mp32022-08-14 03:50 88K 
[SND]K_DA - 'POP_STARS' LYRICS (ft (G)I-DLE, Madison Beer, Jaira Burns) (Color Coded Eng_Rom_Han_가사).mp32022-08-14 03:49 0  
[SND]K_DA - POP_STARS (ft. Madison Beer, (G)I-DLE, Jaira Burns) _ Music Video - League of Legends.mp32022-08-14 03:42 0  
[SND]KINGDOM(킹덤) '단심가' MV (128 kbps).mp32022-08-14 03:36 0  
[SND]rahmanh1.mp32022-08-14 03:27 0  
[SND]SBS.mp32022-08-14 03:24 0  
[SND]tian.mp32022-08-14 03:24 1.1M 
[SND]X2Download.com - THE TOYS - เมะ (kiss by kiss) [Official Lyrics] (128 kbps).mp32022-08-14 03:20 0  
[SND]KUBURAN.mp32022-08-14 03:19 0  
[SND]heart.mp32022-08-14 03:17 0  
[SND]mp98.mp32022-08-14 03:16 0  
[SND]Chocolate_factory_-_Heartbreak_Anniversary_(giveon_reggae_cover)(MP3_160K)_1.mp32022-08-14 03:15 0  
[SND]mp99.mp32022-08-14 03:14 0  
[SND]story wa 30 detik _ hari ini selamat ulang tahun untuk diri sendiri.mp32022-08-14 03:14 540K 
[SND]djraher4.mp32022-08-14 03:09 0  
[SND]djkomang.mp32022-08-14 03:07 3.9M 
[SND]djraher3.mp32022-08-14 03:06 0  
[SND]Kavuda.mp32022-08-14 02:59 0  
[SND]Athmavile.mp32022-08-14 02:59 0  
[SND]Shikkari.mp32022-08-14 02:59 0  
[SND]Zara.mp32022-08-14 02:58 0  
[SND]Ranja.mp32022-08-14 02:57 0  
[SND]Let.mp32022-08-14 02:57 3.9M 
[SND]mp21.mp32022-08-14 02:56 3.4M 
[SND]21.mp32022-08-14 02:55 88K 
[SND]mp18.mp32022-08-14 02:54 5.7M 
[SND]19.mp32022-08-14 02:53 1.2M 
[SND]Habibi.mp32022-08-14 02:53 0  
[SND]mp10.mp32022-08-14 02:52 5.1M 
[SND]16.mp32022-08-14 02:51 88K 
[SND]mmk.mp32022-08-14 02:51 1.8M 
[SND]Cent1.mp32022-08-14 02:51 0  
[SND]asu.mp32022-08-14 02:51 1.5M 
[SND]mp12.mp32022-08-14 02:51 3.7M 
[SND]13.mp32022-08-14 02:49 4.1M 
[SND]mp14.mp32022-08-14 02:48 268K 
[SND]mp15.mp32022-08-14 02:47 3.6M 
[SND]mp16.mp32022-08-14 02:46 5.4M 
[SND]mp17.mp32022-08-14 02:45 236K 
[SND]INDO1945.mp32022-08-14 02:45 0  
[SND]Bocil28.mp32022-08-14 02:39 0  
[SND]firstbeatwip.mp32022-08-14 02:37 0  
[SND]Dhije4.mp32022-08-14 02:36 3.3M 
[SND]rap.mp32022-08-14 02:33 2.7M 
[SND]pler2.mp32022-08-14 02:29 0  
[SND]aaaa.mp32022-08-14 02:24 3.0M 
[SND]untukapa.mp32022-08-14 02:24 0  
[SND]rap1.mp32022-08-14 02:18 2.0M 
[SND]mp100.mp32022-08-14 02:18 0  
[SND]ssstik.io_1660442087212.mp32022-08-14 02:16 0  
[SND]Krovostok_-_Biografiya_55628538.mp32022-08-14 02:14 0  
[SND]secukupnya.mp32022-08-14 02:13 0  
[SND]Wasky8.mp32022-08-14 02:12 3.5M 
[SND]salmonela.mp32022-08-14 02:10 0  
[SND]W.mp32022-08-14 02:10 3.5M 
[SND]G.mp32022-08-14 02:10 2.1M 
[SND]WALTER.mp32022-08-14 02:10 0  
[SND]S.mp32022-08-14 02:10 0  
[SND]TOKYO.mp32022-08-14 02:10 0  
[SND]U.mp32022-08-14 02:10 0  
[SND]ASEDE.mp32022-08-14 02:10 0  
[SND]B.mp32022-08-14 02:10 552K 
[SND]Wasky9.mp32022-08-14 02:10 0  
[SND]pler4.mp32022-08-14 02:09 0  
[SND]nanda.mp32022-08-14 02:08 0  
[SND]Wasky11.mp32022-08-14 02:07 0  
[SND]mh.mp32022-08-14 02:06 0  
[SND]bv.mp32022-08-14 01:58 160K 
[SND]Alex.mp32022-08-14 01:54 4.3M 
[SND]Wasky10.mp32022-08-14 01:53 2.3M 
[SND]y2mate.com - Nhạc Trẻ Remix 2022 Hay Nhất Hiện Nay NONSTOP 2022 Bass Cực MạnhViệt Mix Dj Nonstop 2022 Vinahouse.mp32022-08-14 01:52 0  
[VID]lv_7115088159393811714_20220814084520.mp42022-08-14 01:46 0  
[SND]dj.mp32022-08-14 01:41 0  
[SND]Disturbed • The Sound of Silence 000.mp32022-08-14 01:07 2.0M 
[SND]bgndl22.mp32022-08-14 01:00 0  
[SND]clan1.mp32022-08-14 00:59 0  
[SND]Cali.mp32022-08-14 00:57 2.2M 
[SND]Mad.mp32022-08-14 00:47 0  
[SND]прклетыи фаил дело в шляпе нюхаи бебру.m4a2022-08-14 00:41 0  
[SND]очень страшная проклетая музыка я верю в чудеса слышу все голоса.m4a2022-08-14 00:39 0  
[SND]PvZ.mp32022-08-14 00:37 0  
[SND]Random1.mp32022-08-14 00:32 0  
[SND]short-success-sound-glockenspiel-treasure-video-game-6346.mp32022-08-14 00:29 0  
[SND]bgnll.mp32022-08-14 00:28 0  
[SND]страшныи ад.m4a2022-08-14 00:27 0  
[SND]страшно печальныи ад.m4a2022-08-14 00:27 0  
[SND]Placebo_-_Running_Up_That_Hill_(getmp3.pro).mp32022-08-14 00:27 5.9M 
[SND]страшная музыка.m4a2022-08-14 00:26 3.5M 
[SND]jaxtin.mp32022-08-14 00:25 0  
[SND]очень страшная музыка для вызывание духов.m4a2022-08-14 00:24 0  
[SND]Migos1.mp32022-08-14 00:14 0  
[SND]crybabyy.mp32022-08-14 00:12 0  
[SND]Kyo1.mp32022-08-14 00:10 0  
[SND]rizqi.mp32022-08-14 00:05 0  
[SND]yt1s.com - Pragmatischer Vernichtungswahn Antisemitismus und Maslahat in der Islamischen Republik Iran.mp32022-08-14 00:01 0  
[SND]Sadabiz.mp32022-08-14 00:00 0  
[SND]_ quotSTAND BY ME quot Full Covered by amp .mp32022-08-13 23:58 0  
[SND]Da.mp32022-08-13 23:51 0  
[SND]bgndl.mp32022-08-13 23:51 0  
[SND]roses1.mp32022-08-13 23:49 3.5M 
[SND]pesanterakhir.mp32022-08-13 23:46 0  
[SND]STAND-BY-ME-Full-Covered-by__duWnJ6nsz0.mp32022-08-13 23:46 0  
[SND]Dj dermaga biru.mp32022-08-13 23:43 0  
[SND]Koffee - Throne.mp32022-08-13 23:36 0  
[SND]Yea.mp32022-08-13 23:32 0  
[SND]pasalubong.mp32022-08-13 23:30 0  
[SND]maybe.mp32022-08-13 23:30 0  
[SND]someday.mp32022-08-13 23:30 0  
[SND]malayo.mp32022-08-13 23:29 4.2M 
[SND]Dio - Rainbow In The Dark - Medieval Style (Bardcore) (128 kbps).mp32022-08-13 23:27 0  
[SND]windah9.mp32022-08-13 23:15 0  
[SND]data.mp32022-08-13 23:09 0  
[SND]russian-low-quality-phonk.mp32022-08-13 23:08 0  
[SND]01. Earth, Wind & Fire with The Emotions - Boogie Wonderland.mp32022-08-13 23:05 0  
[SND]cc.mp32022-08-13 23:04 3.2M 
[SND]Singing Every Song RLN.mp32022-08-13 23:04 0  
[SND]Swinging At Shadows RLN.mp32022-08-13 23:03 0  
[SND]So Good RLN.mp32022-08-13 23:03 0  
[SND]My Lady Of Water And Fire RLN.mp32022-08-13 23:03 0  
[SND]I Will Not Be Broken RLN.mp32022-08-13 23:02 0  
[SND]Maybe Today RLN.mp32022-08-13 23:02 0  
[SND]JACK_DANIELS_-_BLOODS_ATTACK_-_TRA_(getmp3.pro).mp32022-08-13 23:02 0  
[SND]Show You RLN.mp32022-08-13 23:01 0  
[SND]Time RLN.mp32022-08-13 23:01 0  
[SND]Never Fall In Love RLN.mp32022-08-13 23:01 0  
[SND]RdV9.mp32022-08-13 22:59 33M 
[SND]RdV2.mp32022-08-13 22:58 2.9M 
[SND]RdV1.mp32022-08-13 22:57 4.0M 
[SND]Jhon13.mp32022-08-13 22:43 0  
[SND]ShakoPhobia Shake Ya Head Zool Power Final.mp32022-08-13 22:35 0  
[SND]Nenad1.mp32022-08-13 22:30 0  
[SND]Cover.mp32022-08-13 22:23 0  
[SND]Y2Mate.is - Pakistan National Anthem (Instrumental)-A8ZxRKcRJgw-160k-1660240822676.mp32022-08-13 22:09 0  
[SND]bjarla-obryad-sejjd-musmorecom_yRzU3i79.mp32022-08-13 22:09 0  
[SND]fada.mp32022-08-13 22:03 0  
[SND]poki.mp32022-08-13 21:52 0  
[SND]zapahduhov.mp32022-08-13 21:43 0  
[SND][MP3DOWNLOAD.TO] The Ocean Waves Original Soundtrack - First Impression-320k.mp32022-08-13 21:43 0  
[SND]Dhije5.mp32022-08-13 21:42 1.9M 
[SND]Dewa 19 (Feat. Ari Lasso) - Arjuna Mencari Cinta Sounds From The Corner Live 19.mp32022-08-13 21:39 0  
[SND]PLA.mp32022-08-13 21:36 0  
[VID]Gaara1.mp42022-08-13 21:32 0  
[SND]Poylow_BAUWZ_-_Hate_You_feat_Nito-Onna_NCS_Release_320_kbps_73561800 (1).mp32022-08-13 21:32 0  
[SND]Gazaliy3.mp32022-08-13 21:30 0  
[SND]Gazaliy1.mp32022-08-13 21:29 0  
[SND]Gaara1.mp32022-08-13 21:27 0  
[SND]MAK.mp32022-08-13 21:18 0  
[SND]Dixie1.mp32022-08-13 20:57 0  
[SND]meq.mp32022-08-13 20:48 0  
[SND]IFTK0.mp32022-08-13 20:45 0  
[SND]lana_del_rei_x_coolio_-_remix_sickick_(muzrecord.com).mp32022-08-13 20:44 6.4M 
[SND]cave.mp32022-08-13 20:35 0  
[SND]Elisa_Lost_into_the_Night_(Initial_D_1st_Stage _D_Selection 2_)_(www.lightaudio.ru).mp32022-08-13 20:33 0  
[SND]Tama3.mp32022-08-13 20:33 0  
[SND]santuy.mp32022-08-13 20:32 2.7M 
[SND]WhatsApp Audio 2022-08-14 at 1.29.27 AM.mp32022-08-13 20:32 0  
[SND]AudioCutter_Голос 012.m4a2022-08-13 20:30 700K 
[SND]Elisa - Lost Into The Night (dizer.net).mp32022-08-13 20:29 0  
[SND]Dance_With_The_Dead_Kickstart_My_Heart_Remix_67620761.mp32022-08-13 20:27 0  
[SND]russkij_razmer_angel_dna_skuzmin_remix_(muzebra.net).mp32022-08-13 20:19 0  
[SND]Naina Bawre (Tishnagi) - Amit Mishra-(HeroMaza).mp32022-08-13 20:18 0  
[SND]Simaga feat. Shot — На связи (www.lightaudio.ru).mp32022-08-13 20:17 0  
[SND]Kolja Goldstein - Ambassador.mp32022-08-13 20:14 0  
[SND]Fraulein - Victor Wood (Lyrics) 🎶.mp32022-08-13 20:13 0  
[SND]Ama namin [trapremix by sickbeats].mp32022-08-13 20:12 0  
[SND]Jayson In Town - Idana.mp32022-08-13 20:12 0  
[SND]DJ PAK WONG VONG STYLE THAILAND.mp32022-08-13 20:11 0  
[SND]Amanamin2.mp32022-08-13 20:06 0  
[SND]Budotsremix2.mp32022-08-13 20:05 0  
[SND]Fraulein.mp32022-08-13 20:05 0  
[SND]wudbw2.mp32022-08-13 20:05 0  
[SND]BMF X C14 FT SPARTA - BENDO [PROD BY DJ SMZ].mp32022-08-13 20:05 0  
[SND]Idana.mp32022-08-13 20:05 0  
[SND]aryak45.mp32022-08-13 20:02 0  
[SND]DJ BURN FULL BEAT VIRAL TIKTOK TERBARU DJ ASIA REMIX.mp32022-08-13 20:01 0  
[SND]Grove.mp32022-08-13 20:00 0  
[SND]alarm.mp32022-08-13 19:58 76K 
[SND]firaz-shatohin-uhodit-rota-soldat-remix(mp3gid.me).mp32022-08-13 19:56 0  
[SND]Sedihcukasli.mp32022-08-13 19:56 0  
[SND]skinny-pete-zg-movement.mp32022-08-13 19:51 0  
[SND]adamsick.mp32022-08-13 19:48 0  
[SND]reksio_wiertara_145bpm.mp32022-08-13 19:46 0  
[SND]Anees - Sun and Moon Remix (Lyrics) ft. JROA.mp32022-08-13 19:45 0  
[SND]_STING_the_seeen_Mp3.mp32022-08-13 19:41 0  
[SND]_Sting____vybz_Kartel_Dis_Song_MP3.mp32022-08-13 19:38 0  
[SND]RAH Band - Messages from the Stars (minus) +0 semitone.mp32022-08-13 19:35 0  
[SND]Alyss - Pyramid.mp32022-08-13 19:34 0  
[SND]Recording.mp32022-08-13 19:32 0  
[SND]oni_-_Vishnjovaya_semjorka_66036477.mp32022-08-13 19:31 0  
[SND]UCRPWALWALAN.mp32022-08-13 19:20 0  
[SND]JJJJDJ.mp32022-08-13 19:19 1.9M 
[SND]momok.mp32022-08-13 19:19 2.5M 
[SND]Vocaroo 13 Aug 2022 21_14_46 GMT+0200 18YcLIuPjLXJ.mp32022-08-13 19:16 0  
[SND]Cubee1.mp32022-08-13 19:10 0  
[SND]JairoSinclair.mp32022-08-13 19:10 0  
[SND]Achuz1.mp32022-08-13 19:08 0  
[SND]tinder.mp32022-08-13 19:00 2.2M 
[SND]ck2.mp3.mp32022-08-13 18:46 0  
[SND]1530786636_miyagi-captain.mp32022-08-13 18:36 0  
[SND]Instakim_com_tok.mp32022-08-13 18:34 0  
[SND]mlkop1.mp32022-08-13 18:27 0  
[SND]Vladimir Shaikin (_Blacksmith_) — It's Showtime! (Elias' Theme) (www.lightaudio.ru).mp32022-08-13 18:26 0  
[SND]Malaak_op.mp32022-08-13 18:26 0  
[SND]ck1.mp3.mp32022-08-13 18:25 0  
[SND]Psyco-M - قرن الشيطان.mp32022-08-13 18:23 0  
[SND]instasamka_love.mp32022-08-13 18:23 0  
[SND]инстасамка.mp32022-08-13 18:16 0  
[SND]Viktor_Cojj_-_Gruppa_krovi_47828908.mp32022-08-13 18:15 0  
[SND]one50.mp32022-08-13 18:08 0  
[SND]ck.mp3.mp32022-08-13 18:06 888K 
[SND]YKC2.mp32022-08-13 18:06 0  
[SND]cube2.mp32022-08-13 18:01 0  
[SND]Rae.mp32022-08-13 18:01 3.4M 
[SND]cube1.mp32022-08-13 18:01 0  
[SND]Gor_-_Dorogu_molodym_Prod_by_Karimbeatz_72998822.mp32022-08-13 17:54 0  
[SND]Tadoww.mp32022-08-13 17:51 0  
[SND]MiyaGi_Andy_Panda_-_Kassandra_Kosandra_68417287.mp32022-08-13 17:51 0  
[SND]Ojo.mp32022-08-13 17:50 0  
[SND]the-limba-oni-nazyvayut-menya-boss-mp3.mp32022-08-13 17:46 0  
[SND]keii.mp32022-08-13 17:46 0  
[SND]Amber_-_Energy.mp32022-08-13 17:39 0  
[SND]boma.mp32022-08-13 17:36 0  
[SND]Tadow.mp32022-08-13 17:33 0  
[SND]y2mate.com - Yeni Inka ft Farel Prayoga Joko TIngkir Ngombe Dawet Official Music Video ANEKA SAFARI.mp32022-08-13 17:29 0  
[SND]hm.mp32022-08-13 17:27 0  
[SND]ziya21.mp32022-08-13 17:22 0  
[SND]situation log updated xenophobe.mp32022-08-13 17:21 0  
[SND]y2mate.com - MERINDU LAGI YOVIE AND NUNO LIRIK .mp32022-08-13 17:21 0  
[SND]lagugg1.mp32022-08-13 17:17 0  
[SND]Baumwolle-Raffael-A-Speechelo.mp32022-08-13 17:15 0  
[SND]7. 장난스런 키스.mp32022-08-13 17:13 0  
[SND]Dhije7776.mp32022-08-13 17:10 0  
[SND]BGM Paris.mp32022-08-13 17:09 0  
[SND]Dhije887.mp32022-08-13 17:09 0  
[SND]01. スーパーウルトラハイパーミラクルロマンチック.mp32022-08-13 17:08 0  
[SND]Arut, Big Baby Tape - VLAGA.mp32022-08-13 17:07 0  
[SND]01. ambiguous.mp32022-08-13 17:07 0  
[SND]Joji - Glimpse of Us (Lyrics).mp32022-08-13 17:05 3.6M 
[SND]A$AP Rocky - Lord Pretty Flacko Jodye 2 (LPFJ2).mp32022-08-13 17:05 0  
[SND]MORGENSHTERN_-_Novyjj_Merin_66404393.mp32022-08-13 17:05 0  
[SND]89.mp32022-08-13 17:04 0  
[SND]5.mp32022-08-13 17:04 1.1M 
[SND]DGK5.mp32022-08-13 16:56 2.0M 
[SND]Vijay.mp32022-08-13 16:55 1.1M 
[SND]Ghostemane - Mercury.mp32022-08-13 16:54 2.9M 
[SND]SAMBLACK - ไม่เคยรักกัน ft. PUNYARB (Official Lyrics Video).mp32022-08-13 16:50 2.3M 
[SND]เธอเด็ด (feat. OHOTDAD).mp32022-08-13 16:50 0  
[SND]Ck.mp32022-08-13 16:48 2.8M 
[SND]DJ BOOMA BOOMA YEE TIK TOK REMIX TERBARU 2021 (DJ IMUT REMIX).mp32022-08-13 16:48 352K 
[SND]E.mp32022-08-13 16:46 4.1M 
[SND]Ra.mp32022-08-13 16:44 3.4M 
[SND]Thalu.mp32022-08-13 16:44 0  
[SND]Y.mp32022-08-13 16:42 3.3M 
[SND]titan.mp3.mp32022-08-13 16:42 0  
[SND]Forrozão Astral - Dança do Elicopo(MP3_128K).mp32022-08-13 16:42 0  
[SND]AUD-20220720-WA0009.mp32022-08-13 16:42 0  
[SND]KONG.mp32022-08-13 16:42 0  
[SND]MGRP LOADING SCREEN , V2 , 2K21 EDITION.mp32022-08-13 16:40 0  
[SND]Ulol.mp32022-08-13 16:38 0  
[SND]Raid - FUCK OFF II_كفاحي - instrumental(MP3_160K).mp32022-08-13 16:34 0  
[SND]1-5.mp32022-08-13 16:32 0  
[SND]Fire.mp32022-08-13 16:32 0  
[SND]MOSLIM12.mp32022-08-13 16:31 0  
[SND]carl5.mp32022-08-13 16:30 0  
[SND]carl4.mp32022-08-13 16:30 0  
[SND]carl3.mp32022-08-13 16:30 0  
[SND]carl2.mp32022-08-13 16:23 3.7M 
[SND]flare.mp32022-08-13 16:22 0  
[SND]Carl1.mp32022-08-13 16:22 0  
[SND]wo.mp32022-08-13 16:21 0  
[SND]badgirllllll05_20220813_3.mp32022-08-13 16:20 0  
[SND]---------- - --_---- ---- ---------- ---- (----------) [------------ _ ------------](MP3_128K).mp32022-08-13 16:17 0  
[SND]COMBI.mp32022-08-13 16:16 0  
[SND]fire1.mp32022-08-13 16:16 0  
[SND]fire2.mp32022-08-13 16:13 0  
[SND]santuycug1.mp32022-08-13 16:13 0  
[SND]anali1.mp32022-08-13 16:09 0  
[SND]y2mate.com - Defamilita YK Song to My Friend Lyric.mp32022-08-13 16:07 0  
[SND]payp0n.mp32022-08-13 16:06 788K 
[SND]nama2.mp32022-08-13 16:02 0  
[SND]nama1.mp32022-08-13 16:01 0  
[SND]jolen.mp32022-08-13 16:01 661K 
[SND]Джизус - Запутанный День.mp32022-08-13 16:01 0  
[SND]Tania.mp32022-08-13 16:00 0  
[SND]ssstik.io_1657257212140.mp32022-08-13 15:59 0  
[SND]ssstik.io_1653241824950.mp32022-08-13 15:58 0  
[SND]na.mp32022-08-13 15:57 2.3M 
[SND]Valt%.mp32022-08-13 15:57 0  
[SND]Goro - Дорогу молодым (Slowed Remix).mp32022-08-13 15:55 0  
[VID]badgirllllll05_20220813_3.mp42022-08-13 15:55 0  
[SND]PLOHOYPAREN, blago white - Благо Воронин плохой вор.mp32022-08-13 15:54 464K 
[SND]shadowraze_-_showdown_73909739.mp32022-08-13 15:54 4.7M 
[SND]maribercinta.mp32022-08-13 15:54 3.9M 
[SND]shadowraze_-_astral_step_73249837.mp32022-08-13 15:54 0  
[SND]NIKI11.mp32022-08-13 15:53 0  
[SND]y2mate.com - Different Heaven Safe And Sound NCS Release.mp32022-08-13 15:53 2.9M 
[SND]Chernikovskaya_Hata_-_Belaya_noch_69755145.mp32022-08-13 15:52 0  
[SND]y2mate.com - VIRAL TIK TOK NI MERIANG DJANDRIHANTAKAN FT BY ENC DJ RIZKY GOKIELZ ENAKK KALII.mp32022-08-13 15:50 0  
[SND]The Zombie Song (Wolfychu Animation) (AvdioTrik.com).mp32022-08-13 15:49 0  
[SND]PLER.mp32022-08-13 15:47 0  
[SND]Mbc1.mp32022-08-13 15:44 0  
[SND]mmuli.mp32022-08-13 15:40 0  
[SND]Bi-2_-_CHernoe_solnce_(new.muzikavsem.org).mp32022-08-13 15:38 0  
[SND]dhije1.mp32022-08-13 15:38 3.6M 
[SND]PhaoH.mp32022-08-13 15:38 0  
[SND]Cho.mp32022-08-13 15:38 0  
[SND]BCCT.mp32022-08-13 15:38 0  
[SND]Minion.mp32022-08-13 15:38 0  
[SND]BTTL.mp32022-08-13 15:38 0  
[SND]Siuuu.mp32022-08-13 15:38 0  
[SND]Ghast1.mp32022-08-13 15:38 0  
[SND]aoa.mp32022-08-13 15:37 0  
[SND]chajj-vdvoem-den-rozhdenja.mp32022-08-13 15:34 0  
[SND]Falk - vs. YINU.mp32022-08-13 15:33 0  
[SND]Nox Arcana - A Touch of Evil.mp32022-08-13 15:31 0  
[SND]Aisy.mp32022-08-13 15:30 0  
[SND]alvin.mp32022-08-13 15:28 0  
[SND]Srp2.mp32022-08-13 15:27 308K 
[SND]Sad.mp32022-08-13 15:26 0  
[SND]lugowo3.mp32022-08-13 15:21 4.3M 
[SND]seph1.mp32022-08-13 15:20 2.2M 
[SND]erpe.mp32022-08-13 15:19 1.8M 
[SND]NIKI - Strange Land (Live) Acoustic Sessions.mp32022-08-13 15:17 0  
[SND]Olivia Rodrigo - drivers license (Official Video).mp32022-08-13 15:17 0  
[SND]Ace_Attorney_-_Cross_Examination_Allegro_2001_(Gybka.com).mp32022-08-13 15:17 0  
[SND]btr.mp32022-08-13 15:16 0  
[SND]The Final Flash of Existence (SCP_ Secret Laboratory Main Theme).mp32022-08-13 15:15 548K 
[SND]7071033479907085062.mp32022-08-13 15:12 0  
[SND]Ulligaddauttej.mp32022-08-13 15:11 0  
[SND]chill.mp32022-08-13 15:09 2.6M 
[SND]WENARO_LXNER_-_Ljod_73215474.mp32022-08-13 15:04 0  
[SND]MBC1.mp32022-08-13 15:01 0  
[SND]NOCOMMENT.mp32022-08-13 15:00 0  
[SND]Djlugowo.mp32022-08-13 14:59 0  
[SND]Isolateexe_-_Crystals_(musmore.com).mp32022-08-13 14:56 5.3M 
[SND]AUD-20220813-WA0041.mp32022-08-13 14:56 0  
[SND]Wasky4.mp32022-08-13 14:53 0  
[SND]y2mate.com - din bhar ki khabar news of the day hindi news india top news Bihar Politics Rahul dblive.mp32022-08-13 14:50 0  
[SND]meomor.mp32022-08-13 14:46 0  
[SND]Indila Love Story .mp32022-08-13 14:44 0  
[SND]Eminem2.mp32022-08-13 14:44 4.4M 
[SND]pler3.mp32022-08-13 14:41 0  
[SND]Floods (live) - Pantera.mp32022-08-13 14:41 0  
[SND]hayun4.mp32022-08-13 14:37 0  
[SND]Jennie5.mp32022-08-13 14:36 0  
[SND]KNOCK.mp32022-08-13 14:36 0  
[SND]djbasindir.mp32022-08-13 14:36 0  
[SND]HOYO-MiX - Lithic Oath.mp32022-08-13 14:36 0  
[SND]HOYO-MiX - On the Vast Earth.mp32022-08-13 14:34 0  
[SND]hayun2.mp32022-08-13 14:33 1.2M 
[SND]vp2.mp32022-08-13 14:30 2.3M 
[SND]vp1.mp32022-08-13 14:29 4.9M 
[SND]KUMPULAN DJ FYP TIKTOK 2022 SOUND KANE JEDAG JEDUG FUL BAS TERBARU (129K).m4a2022-08-13 14:26 0  
[SND]hayun3.mp32022-08-13 14:26 0  
[SND]Biggie.mp32022-08-13 14:26 0  
[SND]Indila - Love Story _ lyrics terjemahan.mp32022-08-13 14:24 504K 
[VID]VID-20220812-WA0005.mp42022-08-13 14:24 0  
[VID]3d2a2638fa7fa2a3ab63489c8b953f42.mp42022-08-13 14:20 0  
[SND]bbhc1.mp32022-08-13 14:15 0  
[SND]Ch12.mp32022-08-13 14:15 0  
[SND]Ghost - Mary On A Cross (radio.lol).mp32022-08-13 14:13 0  
[SND]dobado.mp32022-08-13 14:12 0  
[SND]Chismiz.mp32022-08-13 14:11 60K 
[SND]Макс Корж - 2 Типа Людей (megasongs.me).mp32022-08-13 14:09 0  
[SND]chi.mp32022-08-13 14:08 0  
[SND]God-is-a-Girl-Radio-Edit-Groove-Coverage_LmpIZceO6k0.mp32022-08-13 14:08 0  
[SND]sismis.mp32022-08-13 14:07 0  
[SND]DJ-ONE-DAY-X-LALALA-REMIX-TERBARU-FULL-BASS-DJ-Opus_EK5-xDqx4Eo.mp32022-08-13 14:05 0  
[SND]DJ-CLOSE-YOUR-EYES-X-BANGUN-TIDUR-X-GAM-GAM-TEKI-TEKI-TIKTOK-VIRAL-REMIX-FULL-BASS-2022_5OMFlNtoVTs.mp32022-08-13 14:03 0  
[SND]y2mate.com - DJ CAMPURAN VIRAL TIKTOK 2022 JEDAG JEDUG FULL BASS TERBARU.mp32022-08-13 14:01 2.0M 
[SND]Wasky5.mp32022-08-13 13:59 0  
[SND]Avenged-Sevenfold-Until-the-End-Official-Audio_0JGnGSQk6FA.mp32022-08-13 13:59 0  
[SND]Wasky6.mp32022-08-13 13:59 0  
[SND]DJ HAY TOCH SOUTH AFRICA & NIGERIA SOUND MIX.mp32022-08-13 13:58 22M 
[SND]Wasky3.mp32022-08-13 13:58 2.8M 
[SND]RAOF4.mp32022-08-13 13:58 7.8M 
[SND]ArizonaRP.mp32022-08-13 13:57 4.1M 
[SND]hayun1.mp32022-08-13 13:56 5.0M 
[SND]vp6.mp32022-08-13 13:56 3.7M 
[SND]6.TOO BAD OUTRO.mp32022-08-13 13:55 0  
[SND]5.OHH LORD(SOLO)(R).mp32022-08-13 13:55 0  
[SND]4.NOW N EVER.mp32022-08-13 13:55 0  
[SND]3.TOO GANGSTAR.mp32022-08-13 13:55 0  
[SND]Tiara.mp32022-08-13 13:54 3.9M 
[SND]2.CLICK BANG BANG.mp32022-08-13 13:54 0  
[SND]1.CLICK INTRO.mp32022-08-13 13:54 0  
[SND]Rolex Entry Bgm | Rolex Entry Full Bgm | Lokiverse Bgm | [Download Link].mp32022-08-13 13:53 0  
[SND]RAOF3.mp32022-08-13 13:52 0  
[SND]kaamelott-s01e01.mp32022-08-13 13:52 668K 
[SND]vp5.mp32022-08-13 13:52 2.3M 
[SND]vp4.mp32022-08-13 13:51 2.8M 
[SND]RAOF1.mp32022-08-13 13:50 0  
[SND]WRT.mp32022-08-13 13:47 0  
[SND]vp3.mp32022-08-13 13:42 236K 
[SND]wtd2.mp32022-08-13 13:41 0  
[SND]THRILL PILL - Миллионы.mp32022-08-13 13:38 0  
[SND]Макс Корж - 2 типа людей.mp32022-08-13 13:38 9.8M 
[SND]Wish You Were Here.mp32022-08-13 13:38 6.2M 
[SND]Vp8.mp32022-08-13 13:37 79K 
[SND]Nuha-Bahrin-Naufal-Azrin-CASABLANCA-Lyric-Video_GQYQXfV6AVw.mp32022-08-13 13:35 0  
[SND]ILS.mp32022-08-13 13:34 0  
[SND]Lokiverse Theme Video - Vikram _ Kamal Haasan _ ANIRUDH RAVICHANDER _ Lokesh Kanagaraj.mp32022-08-13 13:32 0  
[SND]wtd1.mp32022-08-13 13:28 384K 
[SND]vmrpintro.mp32022-08-13 13:28 1.3M 
[SND]TOBA5.mp32022-08-13 13:27 0  
[SND]Yama15.mp32022-08-13 13:27 0  
[SND]Bodiev_-_Karuseli_64743001.mp32022-08-13 13:26 0  
[SND]TOBA3.mp32022-08-13 13:26 0  
[SND]alox.mp32022-08-13 13:26 0  
[SND]hey,thats pretty good..mp32022-08-13 13:25 0  
[SND]kanankiri.mp32022-08-13 13:25 1.7M 
[SND]bgm2vmrp.mp32022-08-13 13:24 0  
[SND]y2mate.com - REMIX KOPLO DOTA Basshunter x Milos x Dimitri.mp32022-08-13 13:23 1.8M 
[SND]KADAM KADAM.mp32022-08-13 13:23 2.6M 
[SND]san.mp32022-08-13 13:19 0  
[SND]KADAM KADAM BADHAYE JA _ A TRIBUTE TO NETAJI SUBHASH CHANDRA BOSE.mp32022-08-13 13:19 0  
[SND]wavvmrp.mp32022-08-13 13:18 0  
[SND]ktdas.mp32022-08-13 13:17 3.2M 
[SND]Ungol.mp32022-08-13 13:16 85K 
[SND]797393120.mp32022-08-13 13:15 3.8M 
[SND]The Rolling Stones - Heaven.mp32022-08-13 13:15 0  
[SND]Патрон (remix).mp32022-08-13 13:14 0  
[SND]mai.mp32022-08-13 13:14 2.9M 
[SND]Детство (Remix).mp32022-08-13 13:13 0  
[SND]Суета (remix).mp32022-08-13 13:12 0  
[SND]Стрелы.mp32022-08-13 13:11 0  
[SND]itwilrain.mp32022-08-13 13:11 0  
[SND]Беги (remix).mp32022-08-13 13:11 0  
[SND]-Kordhell - Live Another Day.mp32022-08-13 13:10 0  
[SND]MOBE1.mp32022-08-13 13:10 0  
[SND]Led Zeppelin -The Rain Song.mp32022-08-13 13:08 0  
[SND]Dilemma1.mp32022-08-13 13:06 0  
[SND]murat-tkhagalegov-chuzhaja-nevesta.mp32022-08-13 13:06 11M 
[SND]luyaa0.mp32022-08-13 13:05 0  
[SND]miyagi.mp32022-08-13 13:04 0  
[SND]SIKOK.mp32022-08-13 13:03 0  
[SND]Bjf.mp32022-08-13 12:59 1.2M 
[SND]PharaoH - На Луне.mp32022-08-13 12:53 0  
[SND]anjay.mp32022-08-13 12:45 7.0M 
[SND]byines.mp32022-08-13 12:45 0  
[SND]Mursit3.mp32022-08-13 12:44 0  
[SND]stia.mp32022-08-13 12:42 0  
[SND]mursit2.mp32022-08-13 12:42 0  
[SND]shahmen-mark-remastered.mp32022-08-13 12:41 0  
[SND]asmara.mp32022-08-13 12:39 0  
[SND]Mursit1.mp32022-08-13 12:36 0  
[SND]D.mp32022-08-13 12:36 3.8M 
[SND]Rap1.mp32022-08-13 12:35 4.7M 
[SND]Yoi.mp32022-08-13 12:35 0  
[SND]cukup1.mp32022-08-13 12:33 0  
[SND]Oliver_Tree_-_Jerk_70287833.mp32022-08-13 12:30 2.3M 
[SND]XXXTENTACION - Hope.mp32022-08-13 12:29 0  
[SND]Hoa Ngọc Lan 2.mp32022-08-13 12:29 0  
[SND]DJ MARI SEMUA DANSA DENGANKU JEDAG JEDUG MENGKANE VIRAL TIKTOK [ DJ MARI BERCINTA ] MBON MBON REMIX.mp32022-08-13 12:27 0  
[SND]Yama11.mp32022-08-13 12:25 0  
[SND]BBHC.mp32022-08-13 12:24 624K 
[SND]fendonOFF — Nikitata - Дресскод x Shadowraze - Astral step (www.lightaudio.ru).mp32022-08-13 12:23 0  
[SND]meqmeq.mp32022-08-13 12:22 0  
[SND]riw - “Jump On, Jump On Me” (Sped Up).mp32022-08-13 12:18 1.3M 
[SND]gov1.mp32022-08-13 12:17 0  
[SND]lalalas.mp32022-08-13 12:17 0  
[SND]cuy.mp32022-08-13 12:16 0  
[SND]_OLD GENESIS_ ( Prod Lemuel J. Sianipar ).mp32022-08-13 12:15 0  
[SND]antom.mp32022-08-13 12:14 184K 
[SND]hutdog.mp32022-08-13 12:09 0  
[SND]PseudoRauschSingnale (DJ Cannabis Coffeeshops Deutschland).mp32022-08-13 12:08 0  
[SND]Zexx1.mp32022-08-13 12:07 0  
[SND]Zexx3.mp32022-08-13 12:07 0  
[SND]Zexx2.mp32022-08-13 12:06 0  
[SND]Zexx.mp32022-08-13 12:06 1.2M 
[SND]zawanbeats-low.mp32022-08-13 12:06 412K 
[SND]jj.mp32022-08-13 12:04 2.8M 
[SND]SE.mp32022-08-13 12:01 0  
[SND]Dilemma.mp32022-08-13 12:01 0  
[SND]moon.mp32022-08-13 12:00 80K 
[SND]epma.mp32022-08-13 11:57 4.7M 
[SND]HRD2FACE.mp32022-08-13 11:50 3.7M 
[SND]mmmm.mp32022-08-13 11:47 3.6M 
[SND]gta1.mp32022-08-13 11:41 1.1M 
[SND]ROG.mp32022-08-13 11:38 0  
[SND]WENA VIRAL.mp32022-08-13 11:38 0  
[SND]rnn.mp32022-08-13 11:38 2.4M 
[SND]CG.mp32022-08-13 11:37 3.0M 
[SND]DJ JUST BLOW - RSTURMIX X VIRAL TIKTOK YANG KALIAN CARII!!!.mp32022-08-13 11:35 0  
[SND]Test9.mp32022-08-13 11:32 0  
[SND]dimegirls.mp32022-08-13 11:31 0  
[SND]habibi.mp32022-08-13 11:30 2.0M 
[SND]alex.mp32022-08-13 11:29 1.4M 
[SND]From Disco saple.mp32022-08-13 11:29 0  
[SND]ชักนมThis is my boss - Lucky Gang (Official Audio)เพลงแก๊งลักกี้ GTAV.mp32022-08-13 11:27 3.3M 
[SND]Papuri Sa Diyos Remix.mp32022-08-13 11:25 1.2M 
[SND]inbound841772282173309966.mp32022-08-13 11:22 0  
[SND]Merdeka.mp32022-08-13 11:21 0  
[SND]Papuri2.mp32022-08-13 11:20 0  
[SND]ajoura_the_scp_foundation_main_theme_audio_spectrum_1hour_431074591912028817.mp32022-08-13 11:17 0  
[SND]nenengb.mp32022-08-13 11:16 0  
[SND]inbound44909169936502260.mp32022-08-13 11:15 0  
[SND]kontrabida.mp32022-08-13 11:15 0  
[SND]ff.mp32022-08-13 11:13 2.0M 
[SND]gtaslowed.mp32022-08-13 11:12 0  
[SND]JUKI -_ VILLAIN [ prod. ESKRY ].mp32022-08-13 11:12 0  
[SND]djwb.mp32022-08-13 11:09 0  
[SND]Yama2.mp32022-08-13 11:08 0  
[SND]Maybe.mp32022-08-13 11:03 0  
[SND]SaveTube.App - Doowhite On Tour - SAWMENOW x SIIKRET x MADBOZO Prod.TDKILL (Official MV) (128 kbps).mp32022-08-13 11:03 0  
[SND]pwd2.mp32022-08-13 11:01 0  
[SND]g-Stick-your-finger-in-my-ass.mp32022-08-13 11:00 0  
[SND]1MILL.mp32022-08-13 10:56 0  
[SND]FACE_-_MOJJ_KALASHNIKOV_61744829.mp32022-08-13 10:55 0  
[SND]Yama4.mp32022-08-13 10:54 1.9M 
[SND]g-What-the-hell-u-2-doing.mp32022-08-13 10:54 0  
[SND]roberry.mp32022-08-13 10:54 0  
[SND]san punta.mp32022-08-13 10:54 0  
[SND]FACE_-_LABIRINT_66800217.mp32022-08-13 10:54 0  
[SND]20220607_154030.m4a2022-08-13 10:53 0  
[SND]MORGENSHTERN_-_RETRO_REJJV_72972901.mp32022-08-13 10:52 0  
[SND]OST_-_GTA_SA_-_Welcome_to_San_Andreas_64057826.mp32022-08-13 10:52 0  
[SND]face-spasatelnyj-krug-mp3.mp32022-08-13 10:52 0  
[SND]slava-marlow-agoniya-mp3 (1).mp32022-08-13 10:51 28K 
[SND]shadowraze-showdown-mp3.mp32022-08-13 10:51 4.6M 
[SND]face-labirint-mp3 (1).mp32022-08-13 10:51 0  
[SND]neneng.mp32022-08-13 10:50 104K 
[SND]slava-marlow-agoniya-mp3 (2).mp32022-08-13 10:49 0  
[SND]ROBBERY.mp32022-08-13 10:48 0  
[SND]vmrpanthem.mp32022-08-13 10:47 0  
[SND]b.mp32022-08-13 10:46 4.0K 
[SND]gayazov-brother-malinovaya-lada-mp3.mp32022-08-13 10:41 0  
[SND]Markul_streli.mp32022-08-13 10:40 0  
[SND]san ka punta.mp32022-08-13 10:39 0  
[SND]Ninn.mp32022-08-13 10:39 9.3M 
[SND]cr.mp32022-08-13 10:35 0  
[SND]One2.mp32022-08-13 10:32 3.5M 
[SND]Hakdog.mp32022-08-13 10:30 0  
[SND]Clemu.mp32022-08-13 10:29 0  
[SND]niogro.mp32022-08-13 10:26 0  
[SND]vp10.mp32022-08-13 10:25 0  
[SND]Simple Plan - Summer Paradise ft. Sean Paul (Official Video) (320 kbps).mp32022-08-13 10:24 3.5M 
[SND]One3.mp32022-08-13 10:22 2.5M 
[SND]Music Mix 2022 🎧 Remixes of Popular Songs 🎧 EDM Best Music Mix.mp32022-08-13 10:22 0  
[SND]กำลังฮิตในTikTok!! ( โอเคอายูเรดี้ - วอเอ๊ะๆ ) เพลงมาแรงในตอนนี้ 2022 [ดีเจจ๊อบ].mp32022-08-13 10:20 0  
[SND]sanjis01.mp32022-08-13 10:19 0  
[SND]sao.mp32022-08-13 10:18 0  
[SND]กำลังฮิตในTikTok ( เอวติดไฟ -Bear Knuckle) V.แดนซ์ยกเบสหนัก ๆๆ Pao Remix.mp32022-08-13 10:16 0  
[SND]VØJ x TRVNSPORTER Destination (OFFICIAL VISUALIZER).mp32022-08-13 10:15 0  
[SND]iojk.mp32022-08-13 10:15 0  
[SND]Oten.mp32022-08-13 10:14 0  
[SND]231.mp32022-08-13 10:12 0  
[SND]Andrew.mp32022-08-13 10:11 1.9M 
[SND]Myxart.mp32022-08-13 10:05 0  
[SND]Be Notorious (Title Track).mp32022-08-13 10:04 0  
[SND]gone-fludd_-_dripset-prod-by-leezey.mp32022-08-13 10:01 0  
[SND]Алилуя.mp32022-08-13 10:00 0  
[SND]Arthuro1.mp32022-08-13 09:58 1.5M 
[SND]𝓜𝓪𝓶𝓪𝓮𝓿 - Давай со мной до луны и.mp32022-08-13 09:58 1.0M 
[SND]m23.mp32022-08-13 09:58 3.7M 
[SND]Glooco5.mp32022-08-13 09:57 0  
[SND]Papuri.mp32022-08-13 09:57 1.2M 
[SND]rxz.mp32022-08-13 09:57 0  
[SND]Glooco3.mp32022-08-13 09:56 0  
[SND]NEW.mp32022-08-13 09:52 0  
[SND]remix.mp32022-08-13 09:51 2.4M 
[SND]Manuel1.mp32022-08-13 09:47 0  
[SND]𝖇 𝖑 𝖆 𝖈 𝖐🌹𝖜 𝖍 𝖎 𝖙 𝖊 - Звуки урбана [remix].mp32022-08-13 09:47 0  
[SND]asw.mp32022-08-13 09:47 2.7M 
[SND]Мама.mp32022-08-13 09:44 0  
[SND]vp.mp32022-08-13 09:44 0  
[SND]Akala.mp32022-08-13 09:42 3.3M 
[SND]k11.mp32022-08-13 09:41 0  
[SND]THINKIN.mp32022-08-13 09:39 0  
[SND]request200.mp32022-08-13 09:36 0  
[SND]Tibo.mp32022-08-13 09:33 0  
[SND]ndx.mp32022-08-13 09:32 0  
[SND]TONY MOTARO - Boomer Phonk.mp32022-08-13 09:32 0  
[SND]Panda.mp32022-08-13 09:31 1.9M 
[SND]pelangindx.mp32022-08-13 09:30 0  
[SND]AD.mp32022-08-13 09:30 3.9M 
[SND]ssds.mp32022-08-13 09:30 0  
[SND]IPMOSIBL.mp32022-08-13 09:30 0  
[SND]Mr.Kitty - After Dark.mp32022-08-13 09:29 0  
[SND]Skill.mp32022-08-13 09:28 0  
[SND]zodivk-devil-eyes-mp3.mp32022-08-13 09:28 5.2M 
[SND]PapuriRemix.mp32022-08-13 09:22 0  
[SND]puscarie.mp32022-08-13 09:22 0  
[SND]X2Download.com - Move On NDX A.K.A #Lirik (128 kbps).mp32022-08-13 09:21 0  
[SND]bagas.mp32022-08-13 09:17 0  
[SND]The Sh-Booms - Sh-Boom (Life Could Be a Dream).mp32022-08-13 09:12 0  
[SND]Ford.mp32022-08-13 09:12 0  
[SND]The Walters - I Love You So.mp32022-08-13 09:12 0  
[SND]l-lirik.mp32022-08-13 09:10 0  
[SND]mygoo.mp32022-08-13 09:09 0  
[SND]happierkaka.mp32022-08-13 09:08 0  
[SND]Black.mp32022-08-13 09:04 2.4M 
[SND]sean.mp32022-08-13 09:02 0  
[SND]Konfuz-Кайф ты поймала -минус--kissvk.com(1).mp32022-08-13 09:02 0  
[SND]jnh.mp32022-08-13 08:57 0  
[SND]HLD.mp32022-08-13 08:56 1.0M 
[SND]Angel.mp32022-08-13 08:55 3.4M 
[SND]Rex.mp32022-08-13 08:54 2.8M 
[SND]GEY.mp32022-08-13 08:50 0  
[SND]saan.mp32022-08-13 08:45 0  
[SND]Смешарики - От Винта (Bass Boosted By Лампочка 30db) (mp3-2020.com).mp32022-08-13 08:45 0  
[SND]1skill.mp32022-08-13 08:42 0  
[SND]WEGAS, LIANTO, ARCHI - И пусть.mp32022-08-13 08:39 3.2M 
[SND]tipe-x.mp32022-08-13 08:39 0  
[SND]𝕤𝕠𝕦𝕝-𝕄𝕦𝕤𝕚𝕔🎶-𝐘𝐮𝐧𝐨𝐬𝐭.mp32022-08-13 08:37 0  
[SND]CYGO - Panda E.mp32022-08-13 08:35 0  
[SND]Sohodolls - Pleasures of Soho.mp32022-08-13 08:35 0  
[SND]Ama.mp32022-08-13 08:35 1.5M 
[SND]REDDY30.mp32022-08-13 08:33 0  
[SND]birth.mp32022-08-13 08:32 0  
[SND]briyanall.mp32022-08-13 08:30 0  
[SND]Çakal - İmdat (Sözleri_Lyrics).m4a2022-08-13 08:29 0  
[SND]animal.mp3.mp32022-08-13 08:26 0  
[SND]Markul, Тося Чайкина - Стрелы.mp32022-08-13 08:24 0  
[VID]X2Download.com- (1).mp42022-08-13 08:22 0  
[SND]awitin.mp3.mp32022-08-13 08:22 0  
[SND]dapainzz.mp32022-08-13 08:19 0  
[SND]Guerro1.mp32022-08-13 08:18 0  
[SND]sosweet.mp3.mp32022-08-13 08:16 0  
[SND]sweet.mp3.mp32022-08-13 08:12 0  
[SND]Tennis - How To Forgive (Visualizer).mp32022-08-13 08:12 0  
[SND]Patriot.mp32022-08-13 08:10 0  
[SND]patriot.mp32022-08-13 08:09 0  
[SND]dkk2.mp32022-08-13 08:08 0  
[SND]galon.mp32022-08-13 08:08 501K 
[SND]Zetsuke.mp32022-08-13 07:53 1.7M 
[SND]empiree.mp32022-08-13 07:53 1.8M 
[SND]20.mp32022-08-13 07:46 2.9M 
[SND]Jhon14.mp32022-08-13 07:45 0  
[SND]All Too Well _ Taylor Swift (Lyrics).mp32022-08-13 07:45 0  
[SND]boigiuadaiduong.mp32022-08-13 07:45 0  
[SND]mgabobo.mp32022-08-13 07:43 0  
[SND]touch.mp3.mp32022-08-13 07:42 0  
[SND]yt1s.com - naanga vanthale vedigundu song whatsapp status havoc brothers songs gkarthi kn.mp32022-08-13 07:38 0  
[SND]OMFG_-_Hello_(musmore.com).mp32022-08-13 07:38 0  
[SND]payphone.mp3.mp32022-08-13 07:32 0  
[SND]ganonparen.mp3.mp32022-08-13 07:25 0  
[SND]touch by touch.mp3.mp32022-08-13 07:21 1.7M 
[SND]phup.mp32022-08-13 07:20 0  
[SND]EMPILIGHT BY JONAS.mp32022-08-13 07:19 4.0K 
[SND]aaa.mp32022-08-13 07:19 2.0M 
[SND]y2mate.com - DJ GENJER GENJER FULL BASS.mp32022-08-13 07:17 0  
[SND]Rolex.mp32022-08-13 07:15 872K 
[SND]TOUCH.mp3.mp32022-08-13 07:15 0  
[SND]JJ1.mp32022-08-13 07:12 0  
[SND]Rolex Theme Video - Vikram - Kamal Haasan - ANIRUDH RAVICHANDER - Lokesh Kanagaraj.mp32022-08-13 07:12 0  
[SND]TOUCH BY TOUCH-by-Joy(w_lyrics)created by_Zairah.mp32022-08-13 07:11 0  
[SND]GetMyWay.mp32022-08-13 07:03 0  
[SND]big_baby_tape_-_99_problems_(feat._kizaru)_muzati.net.mp32022-08-13 07:00 0  
[SND]whataboutme.mp32022-08-13 06:57 0  
[SND]The Weeknd - Blinding Lights (Lyrics) (1).mp32022-08-13 06:55 0  
[SND]mkrvnolvka-Киберпанки2077_(smyslpesni.ru).mp32022-08-13 06:55 0  
[SND]aarne-big-baby-tape-ski-ski.mp32022-08-13 06:55 612K 
[SND]Jhon11.mp32022-08-13 06:53 9.4M 
[SND]koplim.mp32022-08-13 06:52 0  
[SND]iwanna.Mp3.mp32022-08-13 06:50 0  
[SND]Jhon12.mp32022-08-13 06:50 2.1M 
[SND]vmrp22.mp32022-08-13 06:50 0  
[SND]newaugj.mp32022-08-13 06:49 0  
[SND]vmrpaug.mp32022-08-13 06:48 0  
[SND]anto22.mp32022-08-13 06:48 1.9M 
[SND]videoplayback - 2022-08-13T121514.342.mp32022-08-13 06:46 0  
[SND]Vmrpaug.mp32022-08-13 06:44 0  
[SND]aarne-big-baby-tape-ski-ski-mp3.mp32022-08-13 06:43 0  
[SND]Test50.mp32022-08-13 06:42 0  
[SND]edm.mp32022-08-13 06:41 1.6M 
[SND]Glimpes of Us.mp32022-08-13 06:39 0  
[SND]mengejar.mp32022-08-13 06:38 0  
[SND]Test8.mp32022-08-13 06:38 0  
[SND]loki.mp32022-08-13 06:37 2.3M 
[SND]Naruto.mp32022-08-13 06:35 3.8M 
[SND]Test7.mp32022-08-13 06:34 0  
[SND]RR.mp32022-08-13 06:33 2.1M 
[SND]Yama3.mp32022-08-13 06:33 2.2M 
[SND]Jhon10.mp32022-08-13 06:32 8.7M 
[SND]Test13.mp32022-08-13 06:30 0  
[SND]Yama5.mp32022-08-13 06:29 2.8M 
[SND]Test12.mp32022-08-13 06:28 0  
[SND]Test11.mp32022-08-13 06:26 0  
[SND]MV มองได้แต่อย่าชอบ (Official mv OST. ATM) (1).mp32022-08-13 06:24 0  
[SND]Test10.mp32022-08-13 06:24 440K 
[SND]mantrahujan.mp32022-08-13 06:23 1.7M 
[SND]【ORIGINAL SONG MV】Mantra Hujan - Kobo Kanaeru 【hololive Indonesia 3rd Gen】.mp32022-08-13 06:19 0  
[SND]BANCAWAT.mp32022-08-13 06:18 0  
[SND]Test6.mp32022-08-13 06:17 5.3M 
[SND]g5.mp32022-08-13 06:15 1.2M 
[SND]m6.mp32022-08-13 06:13 4.2M 
[SND]m5.mp32022-08-13 06:13 0  
[SND]NDX A.K.A Rasah Dadi Pelangi.mp32022-08-13 06:11 0  
[SND]Test5.mp32022-08-13 06:10 2.0M 
[SND]musik.mp32022-08-13 06:10 524K 
[SND]ssstik.io_1658333440017.mp32022-08-13 06:07 0  
[SND]Test4.mp32022-08-13 06:07 2.0M 
[SND]untilfaund.mp32022-08-13 06:04 0  
[SND]kizumada - macabre.mp32022-08-13 06:04 0  
[SND]mp7.mp32022-08-13 06:02 4.3M 
[SND]nk.mp32022-08-13 06:02 0  
[SND]shadowraze_-_showdown_muzati.net.mp32022-08-13 05:58 4.6M 
[SND]Raze.mp32022-08-13 05:58 902K 
[SND]Test3.mp32022-08-13 05:58 2.5M 
[SND]jhw1.mp32022-08-13 05:58 0  
[SND]tm20.mp32022-08-13 05:56 4.4M 
[SND]tm21.mp32022-08-13 05:56 0  
[SND]mp24.mp32022-08-13 05:55 0  
[SND]Haftway.mp32022-08-13 05:55 0  
[SND]Jason Haft - Bahay Katay (Freestyle Battle Beat).mp32022-08-13 05:54 0  
[SND]mp40.mp32022-08-13 05:54 0  
[SND]jason.mp32022-08-13 05:53 0  
[SND]Meremp3.mp32022-08-13 05:53 0  
[SND]g1.mp32022-08-13 05:53 2.4M 
[SND]g4.mp32022-08-13 05:53 3.5M 
[VID]test.mp42022-08-13 05:53 0  
[SND]m3.mp32022-08-13 05:52 3.5M 
[SND]m4.mp32022-08-13 05:52 3.5M 
[SND]haft.mp32022-08-13 05:52 0  
[SND]Test2.mp32022-08-13 05:45 2.4M 
[SND]Luisterboek Kleine Overheid - Maarten van Rossem.mp32022-08-13 05:45 0  
[SND]My G is HARAM _ Official MV.mp32022-08-13 05:43 0  
[SND]Test1.mp32022-08-13 05:42 2.7M 
[SND]Djslow.mp32022-08-13 05:40 0  
[SND]Feitz1.mp32022-08-13 05:37 0  
[SND]am1.mp32022-08-13 05:37 0  
[SND]tera.mp32022-08-13 05:35 0  
[SND]Video nicht verfügbar (URBANOMP3.NET) (14).mp32022-08-13 05:32 0  
[SND]caidiasd.mp32022-08-13 05:29 0  
[SND]Vacation.mp32022-08-13 05:28 0  
[SND]lovenhe.mp32022-08-13 05:24 0  
[SND]Fdr MusiQ-Danko (feat Tr3azy_a1).mp32022-08-13 05:24 0  
[SND]Thudakam.mp32022-08-13 05:20 0  
[SND]Krutoezvuchanie.mp32022-08-13 05:19 0  
[SND]Tatang2.mp32022-08-13 05:17 0  
[SND]jowo2.mp32022-08-13 05:17 0  
[SND]kuduk.mp32022-08-13 05:13 0  
[SND]Anjay2.mp32022-08-13 05:13 0  
[SND]SHADE.mp3.mp32022-08-13 05:13 0  
[SND]Anjay1.mp32022-08-13 05:12 0  
[SND]luce2.mp32022-08-13 05:12 0  
[SND]Madan1.mp32022-08-13 05:11 0  
[SND]sikok.mp32022-08-13 05:08 4.6M 
[SND]berdua.m4a2022-08-13 05:08 0  
[SND]jogja.mp32022-08-13 05:07 400K 
[SND]❤乡𝙎𝙤𝙣𝙢𝙤𝙧乡❤ — Катюша (Phonk Remix by KAMCHATSKYCRAB ft. Cake Beatz) (www.lightaudio.ru).mp32022-08-13 05:06 0  
[SND]Dalaga.mp32022-08-13 05:05 0  
[SND]AUD-20220807-WA0000.mp32022-08-13 05:04 0  
[SND]empire.mp32022-08-13 05:04 0  
[SND]Binata.mp32022-08-13 05:04 0  
[SND]DJSIKOKBAGIDUOREMIXPALEMBANGJEDAGJEDUGMENGKANEVIRALTIKTOK_492.m4a2022-08-13 05:02 0  
[SND]kullbert.mp32022-08-13 05:01 0  
[SND]terluka.mp32022-08-13 04:55 4.3M 
[SND]galau brutal.mp32022-08-13 04:54 0  
[SND]b4.mp32022-08-13 04:52 0  
[SND]mp25.mp32022-08-13 04:50 0  
[SND]miduacinta.mp32022-08-13 04:50 0  
[SND]thde.mp32022-08-13 04:48 0  
[SND]mc2.mp32022-08-13 04:44 0  
[SND]mc.mp32022-08-13 04:44 2.0M 
[SND]mc3.mp32022-08-13 04:44 0  
[SND]mc4.mp32022-08-13 04:44 0  
[SND]mc5.mp32022-08-13 04:44 0  
[SND]ebanko-lyubitel-sobak-ya-ebu-sobak.mp32022-08-13 04:42 5.1M 
[SND]The Living Tombstone.mp32022-08-13 04:36 2.8M 
[SND]LKK.mp32022-08-13 04:33 0  
[SND]b3.mp32022-08-13 04:32 0  
[SND]DJ_INILAH_AKU_RAJA_MEKSIKO_WINDAH_BASUDARA_VIRAL_TIK_TOK_TERBARU_2022(256k).mp32022-08-13 04:29 764K 
[SND]b2.mp32022-08-13 04:29 1.8M 
[SND]KISS.mp32022-08-13 04:24 3.9M 
[SND]OPK.mp32022-08-13 04:23 0  
[VID]Project Fii - 175 _ Style 2 [1728F2C].mp42022-08-13 04:22 0  
[SND]OP.mp32022-08-13 04:14 0  
[SND]Mamz01.mp32022-08-13 04:10 0  
[SND]Cover2.mp32022-08-13 04:10 0  
[SND]Cover1.mp32022-08-13 04:09 0  
[SND]midua cinta.mp32022-08-13 04:09 0  
[SND]DJAKIMILAKUMASIHGANTENGREMIXVIRALTIKTOKTERBARU2022_657.m4a2022-08-13 04:08 476K 
[SND]b1.mp32022-08-13 04:06 2.1M 
[SND]Tren Sexual (letra) _ Pedro Suárez Vértiz (320 kbps).mp32022-08-13 04:02 0  
[SND]roxette - Itu0027s Possible Version One lyrics (YTCONVERT.IN).mp32022-08-13 04:01 0  
[SND]DJ_NO_COMMENT_TUTY_WIBOWO_SOUND_RULL_𝐏𝐑𝐄𝐒𝐄𝐓_VIRAL_FYP_T_n4HqwThT094 (1).mp32022-08-13 04:01 0  
[SND]OnlyMP3.to - Inscryption OST 23 - G0lly's Theme (Uploading)-WHi6TMmQaO0-192k-1643515093319.mp32022-08-13 04:00 0  
[SND]PALOMA AJENA - Aguamarina (YTCONVERT.IN).mp32022-08-13 04:00 0  
[SND]BDM.mp32022-08-13 03:57 0  
[SND]stack game bgm.mp32022-08-13 03:52 0  
[SND]No One Else.mp32022-08-13 03:49 0  
[SND]c3bdb5b8e5ebd8e9a8a84e38f84f879c.mp32022-08-13 03:48 0  
[SND]dem.mp32022-08-13 03:46 0  
[SND]Dj2.mp32022-08-13 03:44 2.4M 
[SND]Until.mp32022-08-13 03:41 1.7M 
[SND]black.mp32022-08-13 03:38 2.4M 
[SND]ruok.mp32022-08-13 03:37 0  
[SND]regards.mp32022-08-13 03:35 0  
[SND]pal.mp32022-08-13 03:35 0  
[SND]sick.mp32022-08-13 03:35 0  
[SND]mp19.mp32022-08-13 03:33 136K 
[SND]P.P.P.mp32022-08-13 03:31 0  
[SND]mixkit-message-pop-alert-2354.mp32022-08-13 03:30 46K 
[SND]mp23.mp32022-08-13 03:30 0  
[SND]V4.mp32022-08-13 03:29 3.3M 
[SND]mp22.mp32022-08-13 03:27 4.7M 
[SND]BDM1.mp32022-08-13 03:27 104K 
[SND]Dj1.mp32022-08-13 03:26 1.1M 
[SND]Arms.mp32022-08-13 03:20 0  
[SND]Abang.mp32022-08-13 03:20 0  
[SND]Alsa.mp32022-08-13 03:19 0  
[SND]Lonte1.mp32022-08-13 03:19 0  
[SND]Kemerdekaan.mp32022-08-13 03:19 0  
[SND]SBD12.mp32022-08-13 03:19 0  
[SND]Funkot1.mp32022-08-13 03:18 0  
[SND]Enakniam12.mp32022-08-13 03:17 0  
[SND]andrew.mp32022-08-13 03:11 3.2M 
[VID]Lost (1).mp42022-08-13 03:08 0  
[SND]S6.mp32022-08-13 03:04 2.7M 
[SND]S5.mp32022-08-13 03:04 3.3M 
[SND]S3.mp32022-08-13 03:03 2.4M 
[SND]S4.mp32022-08-13 03:03 3.6M 
[SND]S2.mp32022-08-13 03:03 2.4M 
[SND]S1.mp32022-08-13 03:03 1.5M 
[SND]y2mate.com - Lagu Kemerdekaan RI 17 Agustus 1945.mp32022-08-13 03:01 168K 
[SND]stay.mp32022-08-13 02:49 2.4M 
[SND]Last night.mp32022-08-13 02:48 0  
[SND]Gtw.mp32022-08-13 02:48 0  
[SND]kagome.mp32022-08-13 02:48 3.7M 
[SND]Falz.mp32022-08-13 02:48 0  
[SND]VP7.mp32022-08-13 02:47 0  
[SND]Grandfather Time.mp32022-08-13 02:46 0  
[SND]29_sua_01.mp32022-08-13 02:42 0  
[SND]海伦 - 画离弦.mp32022-08-13 02:40 0  
[SND]Stay.mp32022-08-13 02:40 1.9M 
[SND]LXSTODIUMmusic.mp32022-08-13 02:27 0  
[SND]pesni_dly_barvifi.mp32022-08-13 02:21 1.2M 
[SND]TakeMeHome.mp32022-08-13 02:08 0  
[SND]X2Download.app - BURUH TANI - MARJINAL __ COVER BY REGITA ECHA (LYRIC) (64 kbps).mp32022-08-13 02:02 0  
[SND]fallen kingdom.mp32022-08-13 02:02 0  
[SND]lgw.mp32022-08-13 01:58 0  
[SND]12082022 - FUNABASHI DAYLIGHT ARCHIE COVER.mp32022-08-13 01:56 0  
[SND]12082022 - public domain archie edit_2.mp32022-08-13 01:55 0  
[SND]12082022- 26032022.mp32022-08-13 01:55 0  
[SND]12082022 - no name_2.mp32022-08-13 01:55 0  
[SND]12082022 - TECHENKO 200821.mp32022-08-13 01:55 0  
[SND]12082022 - FEDO - BE ORIGINAL (ARCHIE DUB).mp32022-08-13 01:54 0  
[SND]Mb.mp32022-08-13 01:54 0  
[SND]12082022 - 27112021.mp32022-08-13 01:54 0  
[SND]12082022 - ARCHIE ID.mp32022-08-13 01:54 0  
[SND]12082022 - riverside.mp32022-08-13 01:54 0  
[SND]12082022 - fest_rozpruwacz_dupy.mp32022-08-13 01:53 0  
[SND]12082022 - ARCHIE FT EQUINOX LAST ONE TO DIE.mp32022-08-13 01:53 0  
[SND]12082022 - 01022022.mp32022-08-13 01:53 0  
[SND]12082022 - 27032022tech-pigeon.mp32022-08-13 01:53 0  
[SND]12082022 - 21112020.mp32022-08-13 01:53 0  
[SND]12082022 - 18112020 intro edm.mp32022-08-13 01:52 0  
[SND]12082022 - 02042022.mp32022-08-13 01:52 0  
[SND]لا تنسي الاشتراك في القناة.mp32022-08-13 01:45 0  
[VID]QO.mp42022-08-13 01:43 0  
[VID]Vp5.mp42022-08-13 01:42 0  
[SND]QO.mp32022-08-13 01:37 2.8M 
[SND]TOT.mp32022-08-13 01:36 0  
[SND]TO.mp32022-08-13 01:34 4.3M 
[SND]OT.mp32022-08-13 01:33 0  
[SND]TR.mp32022-08-13 01:30 200K 
[SND]big-baby-tape-kizaru-bandana-mp3.mp32022-08-13 01:27 0  
[SND]Vp6.mp32022-08-13 01:26 384K 
[SND]Recording (5).mp32022-08-13 01:18 0  
[SND]QC.mp32022-08-13 01:17 0  
[SND]QR.mp32022-08-13 01:16 0  
[SND]y2mate.com - Rain Noise Rain Sound Effect No Copyright Nature Sounds720P HD.mp32022-08-13 01:15 0  
[SND]BM.mp32022-08-13 01:15 0  
[SND]sunrf.mp32022-08-13 01:12 0  
[SND]OQ.mp32022-08-13 01:11 1.3M 
[SND]DO.mp32022-08-13 01:08 0  
[SND]DR.mp32022-08-13 01:07 0  
[SND]k10.mp32022-08-13 01:06 1.0M 
[SND]DH.mp32022-08-13 01:05 0  
[SND]DD.mp32022-08-13 01:02 3.5M 
[SND]DJ.mp32022-08-13 01:00 0  
[SND]k7.mp32022-08-13 00:51 0  
[SND]S23.mp32022-08-13 00:46 0  
[SND]S25.mp32022-08-13 00:46 0  
[SND]S24.mp32022-08-13 00:46 0  
[SND]S22.mp32022-08-13 00:46 0  
[SND]S21.mp32022-08-13 00:46 0  
[SND]S20.mp32022-08-13 00:46 0  
[SND]Faizan1.mp32022-08-13 00:43 0  
[SND]أغنية مضحكة أمازيغية(MP3_320K).mp32022-08-13 00:38 0  
[SND]k9.mp32022-08-13 00:37 5.1M 
[SND]2022.mp32022-08-13 00:35 3.5M 
[SND]k8.mp32022-08-13 00:32 0  
[SND]Mourad Majjoud - Jibi Police ( Ayli Ayli ) مراد مجود - جيبي البوليس(MP3_320K).mp32022-08-13 00:20 0  
[SND]BEN0.mp32022-08-13 00:11 0  
[SND]bellucci🇮🇹 _ inst_1nurovv - шахрезад «remix» (www.hotplayer.ru).mp32022-08-13 00:09 0  
[SND]prom.mp32022-08-13 00:09 1.8M 
[SND]hamil.mp32022-08-13 00:08 1.7M 
[SND]Cooking_ Great! - The Legend of Zelda_ Breath of the Wild Sound Effect (128 kbps).mp32022-08-13 00:08 0  
[SND]apakabarsayang.mp32022-08-13 00:06 0  
[SND]samp.mp32022-08-12 23:52 4.1M 
[SND]ToiMuonYeuMotNguoi-KhoiMy-5550418.mp32022-08-12 23:50 0  
[SND]shade rex.mp32022-08-12 23:42 0  
[SND]maanghang.mp32022-08-12 23:39 0  
[SND]M.I.B JAK.mp32022-08-12 23:34 0  
[SND]ssstik.io_1660346521753.mp32022-08-12 23:25 0  
[SND]In Game Music Suite (Zuma Deluxe).mp32022-08-12 23:18 0  
[SND]Убей меня, Эйс! – Милая трагедия.mp32022-08-12 23:11 0  
[SND]ktt.mp32022-08-12 23:07 0  
[SND]Hal18.mp32022-08-12 22:47 0  
[SND]akucoba.m4a2022-08-12 22:39 0  
[SND]misha-xramovi-vigimi-mp3.mp32022-08-12 22:32 0  
[SND]Dhikaa61.mp32022-08-12 22:31 0  
[SND]tagne.mp32022-08-12 22:25 0  
[SND]Dere - Berisik (lirik).mp32022-08-12 22:23 0  
[SND]Dhikaa4.mp32022-08-12 22:21 0  
[SND]manu_chao_me_gustas_tu_speed_up-mob4ik.com.mp32022-08-12 22:20 716K 
[SND]ya.mp32022-08-12 22:20 3.0M 
[SND]Budi Doremi - Melukis Senja (Official Video).mp32022-08-12 22:19 0  
[SND]CG5 — Mommy's Here (www.lightaudio.ru).mp32022-08-12 22:17 0  
[SND]cover2.mp32022-08-12 22:14 0  
[SND]cover1.mp32022-08-12 22:14 0  
[SND]Audio Message M.mp32022-08-12 22:11 304K 
[SND]Anthony Zhang.mp32022-08-12 22:05 0  
[SND]AZhangWhisky.mp32022-08-12 21:59 0  
[SND]AZhang.mp32022-08-12 21:55 0  
[SND]Jose ++Elvis Presley .mp32022-08-12 21:48 7.0M 
[SND]Anthony Zhang 1.mp32022-08-12 21:43 0  
[SND]Aarne_Tesno_Feat_BUSHIDO_ZHO_ANIKV.mp32022-08-12 21:41 0  
[SND]DARK1.mp32022-08-12 21:40 0  
[SND]Matre-gims-bella_[www.Bisyor.me].mp32022-08-12 21:36 0  
[SND]morgenshtern-show-club-remix.mp32022-08-12 21:33 0  
[SND]Morgenshtern_Show_Sever_remix.mp32022-08-12 21:31 0  
[SND]Adam Lapierre Director of Wine Vint.mp32022-08-12 21:27 184K 
[SND]VK.mp32022-08-12 21:25 2.4M 
[SND]RR (1).mp32022-08-12 21:23 0  
[SND]Anthony Zhang, Vinovest Cofounder CEO answering What has made whiskey one of the best-performing assets of 2022.mp32022-08-12 21:14 0  
[SND]JOMBLO2.mp32022-08-12 21:13 4.0K 
[SND]The Cad.mp32022-08-12 21:03 0  
[SND]Armağan Oruç - Gun Double.mp32022-08-12 20:58 0  
[SND]Мурат Тхагалегов - Чужая невеста (mp3store.cc).mp32022-08-12 20:55 0  
[SND]DINOAZ-1.mp32022-08-12 20:54 0  
[SND]Барбарики - PHONK REMIX (mp3-2020.com).mp32022-08-12 20:53 1.1M 
[SND]DINO_AZ1.mp32022-08-12 20:51 0  
[SND]Duki - GIVENCHY x Hello Cotto ( Mashup ) ( DJ Hummer Remix ) .mp32022-08-12 20:44 0  
[SND]faydademo.mp32022-08-12 20:43 0  
[SND]Over_the_Horizon.mp32022-08-12 20:33 0  
[SND]PlayaPhonk_-_Phonky_Town_72969550.mp32022-08-12 20:33 0  
[SND]KSLV_Noh_-_Disaster_73210675.mp32022-08-12 20:32 0  
[SND]KSLV_Noh_-_Override_slowed_reverb_74103963.mp32022-08-12 20:32 0  
[SND]Jxid1.mp32022-08-12 20:31 0  
[SND]DISASTER_-_KSLV_Noh_slowed_reverb_320_kbps_73321634.mp32022-08-12 20:31 0  
[SND]MyBe1.mp32022-08-12 20:27 0  
[SND]y2mate.com - Lil Uzi Vert 20 Min.mp32022-08-12 20:24 0  
[SND]Snoop_Dogg_Dr_Dre_-_Still_DRE_47964903.mp32022-08-12 20:23 10M 
[SND]y2mate.com - Playboi Carti Sky Official Audio.mp32022-08-12 20:22 0  
[SND]Dj Azik - Chuchuka (mp3store.cc).mp32022-08-12 20:21 0  
[SND]Dj Azik - Chuchuka (mp3store.cc) (1).mp32022-08-12 20:19 0  
[VID]audioclip-1659980429000-81000.mp42022-08-12 20:18 0  
[SND]vincent.mp32022-08-12 20:18 0  
[SND]danzakudurox.mp32022-08-12 20:11 0  
[SND]CuihX1.mp32022-08-12 20:10 0  
[SND]Три дня дождя - Неважно_(tropicmusic.ru).mp32022-08-12 20:08 0  
[SND]HayukLagu1.mp32022-08-12 20:07 0  
[SND]bili.mp32022-08-12 20:05 0  
[SND]MpE1.mp32022-08-12 20:01 0  
[SND]iniperludienter1 mp3_13-08-22_03-44-05-234.mp32022-08-12 20:01 0  
[SND]Три дня дождя - Неважно.mp32022-08-12 19:58 0  
[SND]yoreyes1.mp32022-08-12 19:54 0  
[SND]Don-Omar-feat-Tego-Calderon_-_Bandaleros-ost-Troynoy-forsazh-Tokiyskiy-drift_(mp3home.me).mp32022-08-12 19:48 0  
[SND]sasa.mp32022-08-12 19:44 0  
[SND]sasa1.mp32022-08-12 19:43 0  
[SND]Sokin1.mp32022-08-12 19:43 0  
[SND]y2mate.com - YG Toxic_320kbps.mp32022-08-12 19:42 0  
[SND]rub.mp32022-08-12 19:38 0  
[SND]Aa.mp32022-08-12 19:32 7.3M 
[SND]Aranc Qez.mp32022-08-12 19:31 0  
[SND]AUD-20220812-WA0017.m4a2022-08-12 19:31 0  
[SND]master.mp32022-08-12 19:27 0  
[SND]palak1.mp32022-08-12 19:26 0  
[SND]Byansi by Collins.mp32022-08-12 19:25 3.5M 
[SND]collins- hellen mastered[HMRecords]0753486667.mp32022-08-12 19:23 0  
[SND]ℂ𝕦𝕓𝕒𝕖𝕤𝕤-🎟-kissvk.com.mp32022-08-12 19:22 0  
[SND]sentimental.mp32022-08-12 19:21 0  
[SND]Yoi1.mp32022-08-12 19:20 0  
[SND]BetterDays.mp32022-08-12 19:19 4.6M 
[SND]LostSky.mp32022-08-12 19:18 0  
[SND]Breezeblocks.mp32022-08-12 19:14 0  
[SND]Dark_Souls_OST_-_Sif_velikij_volk_(Gybka.com).mp32022-08-12 19:13 0  
[SND]Alt-J (∆) _ Breezeblocks Lyrics (HQ).mp32022-08-12 19:12 0  
[SND]FIL1.mp32022-08-12 19:12 0  
[SND]Dhije2.mp32022-08-12 19:11 3.9M 
[SND]Sok3.mp32022-08-12 19:09 0  
[SND]Sok2.mp32022-08-12 19:04 0  
[SND]selamatulangtahun.mp32022-08-12 19:03 0  
[SND]Sokin2.mp32022-08-12 19:02 0  
[SND]MaMu2.mp32022-08-12 18:56 0  
[SND]IUIH.mp32022-08-12 18:51 0  
[SND]lucifer_call_me_devil.mp32022-08-12 18:49 0  
[SND]TryMitis.mp32022-08-12 18:48 0  
[SND]lucifer_call_me_devil_-5547512551233268271.mp32022-08-12 18:48 0  
[SND]Vr.mp32022-08-12 18:47 0  
[SND]Gustixa_-_lemon_tree(256k).mp32022-08-12 18:41 0  
[SND]7063826647098641178.mp32022-08-12 18:39 0  
[SND]D GERRARD - นักวิทยาศาสตร์ (Scientist) (Lyrics).mp32022-08-12 18:38 0  
[SND]lukku11.mp32022-08-12 18:37 0  
[SND]y2mate.com - Gellen Martadinata Selamat Ulang Tahun cover by Moyy.mp32022-08-12 18:37 0  
[SND]yt.mp32022-08-12 18:35 0  
[SND]!positive.mp32022-08-12 18:34 0  
[SND]big-baby-tape-kizaru-so-icy-nihao-file.mp32022-08-12 18:29 0  
[SND]b13ftw.mp32022-08-12 18:26 0  
[SND]TOBA1.mp32022-08-12 18:25 424K 
[VID]Cukup Dikenang Saja.mp42022-08-12 18:22 0  
[SND]DuaLipa.mp32022-08-12 18:18 0  
[SND]Платина feat OG Buda, MAYOT - Abu Dhabi Ba6y.mp32022-08-12 18:17 0  
[SND]1234.mp32022-08-12 18:17 0  
[SND]50.mp32022-08-12 18:15 0  
[SND]123.mp32022-08-12 18:15 2.4M 
[SND]100.mp32022-08-12 18:15 3.3M 
[SND]111.mp32022-08-12 18:15 2.0M 
[SND]31.mp32022-08-12 18:14 1.5M 
[SND]29.mp32022-08-12 18:14 2.4M 
[SND]24.mp32022-08-12 18:14 144K 
[SND]25.mp32022-08-12 18:14 1.0M 
[SND]28.mp32022-08-12 18:14 2.0M 
[SND]26.mp32022-08-12 18:13 1.7M 
[SND]9.mp32022-08-12 18:13 2.4M 
[SND]Whistle.mp32022-08-12 18:13 4.0M 
[SND]Youth.mp32022-08-12 18:13 3.1M 
[SND]0.mp32022-08-12 18:13 524K 
[SND]Things.mp32022-08-12 18:13 4.3M 
[SND]Tsinelas.mp32022-08-12 18:12 3.0M 
[SND]Sweater.mp32022-08-12 18:12 4.3M 
[SND]Stig.mp32022-08-12 18:12 4.8M 
[SND]Thankyou.mp32022-08-12 18:12 3.4M 
[SND]Theway.mp32022-08-12 18:12 2.8M 
[SND]TeleportMe.mp32022-08-12 18:11 2.7M 
[SND]Talk.mp32022-08-12 18:11 2.9M 
[SND]slowly.mp32022-08-12 18:11 2.7M 
[SND]Pogi.mp32022-08-12 18:11 4.1M 
[SND]Staywithme.mp32022-08-12 18:11 1.9M 
[SND]Peekaboo.mp32022-08-12 18:10 3.7M 
[SND]PSG.mp32022-08-12 18:10 2.8M 
[SND]Pahina.mp32022-08-12 18:10 5.2M 
[SND]perfect.mp32022-08-12 18:10 2.3M 
[SND]Own.mp32022-08-12 18:10 3.9M 
[SND]Norem.mp32022-08-12 18:09 4.2M 
[SND]Payday.mp32022-08-12 18:09 2.6M 
[SND]Orasna.mp32022-08-12 18:09 2.6M 
[SND]OneVoice.mp32022-08-12 18:09 2.5M 
[SND]Letme.mp32022-08-12 18:09 3.5M 
[SND]Loki.mp32022-08-12 18:09 2.9M 
[SND]Kontrabida.mp32022-08-12 18:09 5.1M 
[SND]Night.mp32022-08-12 18:08 2.8M 
[SND]Nasasanay.mp32022-08-12 18:08 5.3M 
[SND]big-baby-tape-kari.mp32022-08-12 18:08 0  
[SND]Me.mp32022-08-12 18:08 3.9M 
[SND]big-baby-tape-kizaru-99-problems.mp32022-08-12 18:08 0  
[SND]jamik-samolet-mp3.mp32022-08-12 18:08 0  
[SND]marceline.mp32022-08-12 18:08 2.4M 
[SND]Kings.mp32022-08-12 18:08 2.5M 
[SND]Jamik_feat_ARCHI_Kupyury (1).mp32022-08-12 18:07 0  
[SND]TOBA2.mp32022-08-12 18:06 0  
[SND]big-baby-tape-kizaru-dirrt.mp32022-08-12 18:05 0  
[SND]omda1 (2).mp32022-08-12 18:03 0  
[SND]par.mp32022-08-12 17:59 0  
[SND]happy Birthday versi BT21🤗😂 #bt21🙏#hutri75.mp32022-08-12 17:59 4.0M 
[SND]gor.mp32022-08-12 17:56 0  
[SND]ABBA - Mamma Mia (Jason Kokkovas Pop Punk cover).mp32022-08-12 17:54 0  
[SND]DJ BBHC PYRAMID SLOWED VIRAL TIKTOK (1).mp32022-08-12 17:54 0  
[SND]Onda Cero Entrevista 12 de agosto.mp32022-08-12 17:52 2.9M 
[SND]taek.mp32022-08-12 17:50 233K 
[SND]g6.mp32022-08-12 17:47 3.9M 
[SND]เพลง.mp32022-08-12 17:41 0  
[SND]muli.mp3.mp32022-08-12 17:36 0  
[SND]RAY.mp32022-08-12 17:36 0  
[SND]Slava Marlow - Camry 3.5 (Right Version) ♂Gachi Remix♂ prod.Rat TV (ПЕРЕЗАЛИВ).mp32022-08-12 17:34 824K 
[SND]ROGDJ.mp32022-08-12 17:30 0  
[SND]Anime_de_Japan_Torn_Apart_Bleach_OST_S_5Fn103TaY_3cef74cf.mp32022-08-12 17:30 0  
[SND]tpast.mp3.mp32022-08-12 17:29 0  
[SND]svt.mp32022-08-12 17:29 0  
[SND]TOBA4.mp32022-08-12 17:29 3.1M 
[VID]yt1s.com - غير وحدي مدمر نبغي نسكر عليها نهدر.mp42022-08-12 17:28 0  
[SND]ROG105.mp32022-08-12 17:26 0  
[SND]Tun.mp32022-08-12 17:25 0  
[SND]3 Daqat - Abu Ft. Yousra ثلاث دقات - أبو و يسرا[Mpgun.com].mp32022-08-12 17:23 0  
[SND]wibuu.mp32022-08-12 17:22 0  
[SND]bilel laabidi - Sebt w lahad( rap tounsi ) الغناية الحدث 😂😂 [Mpgun.com].mp32022-08-12 17:21 0  
[SND]Last Child - DUKA (Official Lyric Video).mp32022-08-12 17:17 644K 
[SND]Z9.mp32022-08-12 17:17 4.0M 
[SND]face-yumorist-mp3.mp32022-08-12 17:15 0  
[SND]Techno Ibiza 12-08-202WTF2 10-44.mp32022-08-12 17:15 0  
[SND]Ungu1.mp32022-08-12 17:12 0  
[SND]luffy2.mp32022-08-12 17:11 0  
[SND]H2.mp32022-08-12 17:10 3.9M 
[SND]Galau duka.mp32022-08-12 17:10 0  
[SND]Dj4.mp32022-08-12 17:10 1.2M 
[SND]TOBA.mp32022-08-12 17:10 0  
[SND]luffy3.mp32022-08-12 17:09 0  
[SND]Why This Kolaveri Di Dhanush 320kbps.mp32022-08-12 17:07 0  
[SND]legoislandbuggy.mp32022-08-12 17:07 0  
[SND]Lagnalu 2.0 Dj Govinda GR.mp32022-08-12 17:04 0  
[SND]k4.mp32022-08-12 17:01 4.0M 
[SND]Payphone1.mp32022-08-12 16:58 2.4M 
[SND]Пицца - Фары.mp32022-08-12 16:56 0  
[SND]DAVA & Kara Kross - Бум шакалака.mp32022-08-12 16:54 0  
[SND]as3.mp32022-08-12 16:53 3.6M 
[SND]Swagging.mp32022-08-12 16:52 0  
[SND]Ghostface_Playa_-_Swaggin'_at_the_Partment(128k).mp32022-08-12 16:51 0  
[SND]Rave.mp32022-08-12 16:49 2.4M 
[SND]k2.mp32022-08-12 16:47 4.0M 
[SND]Baumwolle-Max-D-Murf.mp32022-08-12 16:39 0  
[SND]Cheb Mourad - Yahsarah Ki Kounti Tebghini يا حصراه مين كنتي تبغيني (Slowed Reverb)(MP3_128K).mp32022-08-12 16:39 0  
[SND]Baumwolle-Lukas-Talkia.mp32022-08-12 16:35 0  
[SND]badass.mp32022-08-12 16:33 0  
[SND]c1.mp32022-08-12 16:33 4.8M 
[SND]Monster Ending 2 Make it home.mp32022-08-12 16:28 0  
[SND]ytmp3free.cc_uvi-pozdrav-brate-youtubemp3free.org.mp32022-08-12 16:26 0  
[SND]MIDNIGHT.mp32022-08-12 16:24 0  
[SND]anto23.mp32022-08-12 16:24 1.3M 
[SND]Further West Presents The Blank Tapes Cherry Girl Live at Raven Sound Studio.mp32022-08-12 16:22 3.1M 
[SND]Dhije1.mp32022-08-12 16:18 0  
[SND]proemquen.mp32022-08-12 16:17 0  
[SND]แว้นฟอร์มช่าง- 90s Supply (official MV) (1).mp32022-08-12 16:12 0  
[SND]Lesha_Svik_Malinoviy.mp32022-08-12 16:11 1.1M 
[SND]2021 YEAR END MASHUP - SUSH & YOHAN (BEST 130+ SONGS OF 2021).mp32022-08-12 16:07 11M 
[SND]Ghostface.m4a2022-08-12 16:07 1.9M 
[SND]Let Me Down Slowly x Kabhi Jo Badal Barse (Mashup) Alec Benjamin, Arijit Singh oddKidd.mp32022-08-12 16:06 2.8M 
[SND]Petta - Marana Mass Official Video (Tamil) Rajinikanth Anirudh Ravichander.mp32022-08-12 16:06 3.2M 
[SND]wes.mp32022-08-12 16:03 4.2M 
[SND]Mugen Train Ost - Akaza vs Rengoku.mp32022-08-12 16:01 19M 
[SND]anhky.mp32022-08-12 16:01 3.7M 
[SND]Beeping.mp32022-08-12 16:01 0  
[SND]Playa7.mp32022-08-12 15:59 0  
[SND]Sick.mp32022-08-12 15:58 0  
[SND]Playaa.mp32022-08-12 15:58 0  
[SND]Playa.mp32022-08-12 15:58 0  
[SND]chay.mp32022-08-12 15:57 0  
[SND]DJ KU HAMIL DULUAN SUDAH 3 BULAN SOUND USAT PINT VIRAL FYP TIKTOK.mp32022-08-12 15:55 0  
[SND]Beach Bunny - Prom Queen (Official Video).mp32022-08-12 15:55 0  
[SND]pristine2.mp32022-08-12 15:51 0  
[SND]total.mp32022-08-12 15:51 37M 
[SND]Aunt.mp32022-08-12 15:49 0  
[SND]INDRI.mp32022-08-12 15:48 0  
[SND]cj1.mp32022-08-12 15:47 0  
[VID]tan2.mp42022-08-12 15:46 0  
[SND]Bruno.mp32022-08-12 15:46 3.9M 
[SND]Queen.mp32022-08-12 15:45 2.1M 
[SND]Am1.mp32022-08-12 15:44 0  
[SND]ejay2.mp32022-08-12 15:44 0  
[SND]memek.mp32022-08-12 15:43 0  
[SND]Sn.Mp.mp32022-08-12 15:42 0  
[SND]sino.mp32022-08-12 15:40 0  
[SND]requestsino.mp32022-08-12 15:39 0  
[SND]X2Download.com - Jake Hill - dying lately (Full Album) (128 kbps).mp32022-08-12 15:37 0  
[SND]the best Ukrainian songs - BUSHIDO ZHO - Водила чувствует мой вайб.mp32022-08-12 15:37 0  
[SND]UNIQUE.mp32022-08-12 15:37 0  
[SND]Nerve.mp32022-08-12 15:36 0  
[SND]Кореш feat. treepside - Толпа.mp32022-08-12 15:36 0  
[SND]pristine.mp32022-08-12 15:36 0  
[SND]Ytta.mp32022-08-12 15:35 0  
[SND]Beep.mp32022-08-12 15:35 0  
[SND]kavabanga Depo kolibri - Рассвело.mp32022-08-12 15:34 0  
[SND]Kolaveri D-Cypher -- (Sush _ Yohan Mashup)(MP3_128K).mp32022-08-12 15:32 0  
[SND]miku.mp32022-08-12 15:32 0  
[SND]sheesh.m4a2022-08-12 15:32 0  
[SND]Fnatylqrd - Fed up..mp32022-08-12 15:30 0  
[SND]BANGSAD.mp32022-08-12 15:22 1.9M 
[SND]crush.mp32022-08-12 15:22 3.3M 
[SND]Jake_Hill_-_Stay_(Prod._CXDY)(256k).mp32022-08-12 15:19 0  
[SND]LAKEY INSPIRED - Chill Day.mp32022-08-12 15:17 0  
[SND]SAD.mp32022-08-12 15:15 0  
[SND]jo92.mp32022-08-12 15:13 0  
[SND]Narzzpro5.mp32022-08-12 15:09 0  
[SND]Jake Hill - nerve (Lyrics).mp32022-08-12 15:07 2.7M 
[SND]law.mp32022-08-12 15:07 0  
[SND]MARNIK x Alfons x Pule - Harry Potter Style (Lyrics Video).mp32022-08-12 15:06 0  
[SND]Sino.mp32022-08-12 15:04 0  
[SND]Dandelions_-_Ruth_B_(Lyrics_+_Slow_Version)(256k).mp32022-08-12 15:04 0  
[SND]Kendrick Lamar.mp32022-08-12 15:03 0  
[SND]trees.mp32022-08-12 15:03 0  
[SND]alan.mp32022-08-12 15:02 0  
[SND]zaebispizdato.mp32022-08-12 15:02 0  
[SND]Jake Hill - Follow Me Into Hell (EP).mp32022-08-12 15:02 0  
[SND]Jake Hill - Hiding in the Dark.mp32022-08-12 15:00 0  
[SND]fdsfsdf.mp32022-08-12 15:00 0  
[SND]1636722837_imagine-dragons-enemy-from-the-series-arcane-league-of-legends.mp32022-08-12 14:59 0  
[SND]y.mp32022-08-12 14:58 104K 
[SND]Anrufbeantworter einer Irrenanstalt.mp32022-08-12 14:57 0  
[SND]Tik.mp32022-08-12 14:57 0  
[SND]yon.mp32022-08-12 14:57 0  
[SND]unnv-muza-mp3.mp32022-08-12 14:56 0  
[SND]iLOVEFRiDAY-Mia-Khalifa.mp32022-08-12 14:55 804K 
[SND]sed.mp32022-08-12 14:54 950K 
[SND]Dj Mbon.mp32022-08-12 14:52 0  
[SND]Lin.mp32022-08-12 14:52 0  
[SND]Sickomode.mp32022-08-12 14:52 1.2M 
[SND]tom.mp32022-08-12 14:51 1.6M 
[SND]
 - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1).mp32022-08-12 14:50 0  
[SND]
 - ⲋⲉⲭ ʀⲉⲙⲓⲭ _️ (1) (1).mp32022-08-12 14:50 0  
[SND]
 - Missчик.`.mp32022-08-12 14:50 0  
[SND]#Ắί₭Ǿ♫ - Дежавю.mp32022-08-12 14:50 0  
[SND]
 - cексуально. `_.mp32022-08-12 14:50 0  
[SND]
 - 86868.`__.mp32022-08-12 14:50 0  
[SND]
 - Ба ба ба._`.mp32022-08-12 14:50 0  
[SND]
 - _.`.mp32022-08-12 14:50 0  
[SND]- ⲋⲉⲭ ʀⲉⲙⲓⲭ 🕊️.mp32022-08-12 14:50 0  
[SND]
 - cause you are.` _.mp32022-08-12 14:50 0  
[SND]- у меня в планах забрать тебя.`.mp32022-08-12 14:50 3.4M 
[SND]sdhbet.mp32022-08-12 14:47 0  
[SND]Bf.mp32022-08-12 14:46 0  
[SND]hatt.mp32022-08-12 14:45 0  
[SND]- - Corvette' (slow).mp32022-08-12 14:45 0  
[SND]BASS CLUB (автозвук) - Громкий фронт 323.mp32022-08-12 14:45 0  
[SND](29)Migos - Racks 2 Skinny(Screwed By Artem).mp32022-08-12 14:44 0  
[SND]Growna.mp3.mp32022-08-12 14:43 1.5M 
[SND]bubble.mp32022-08-12 14:41 0  
[SND]Lena_Raine_-_Pigstep_Minecraft_OST_69258249.mp32022-08-12 14:33 0  
[SND]Growna1.mp32022-08-12 14:28 0  
[SND]fukiangga.mp32022-08-12 14:28 0  
[SND]anggakul.mp32022-08-12 14:27 0  
[SND]Teger.mp32022-08-12 14:24 0  
[SND]b128453d3e6881d692e2ca81d1d3c94d.mp32022-08-12 14:24 0  
[SND]loginmusic.mp32022-08-12 14:22 0  
[SND]GR 1.MP3.mp32022-08-12 14:22 0  
[SND]link.mp32022-08-12 14:21 3.4M 
[SND]twerk.mp32022-08-12 14:17 0  
[SND]djmerahh.mp32022-08-12 14:16 0  
[SND]luffy.mp32022-08-12 14:14 3.0M 
[SND]Chekele(PagalWorld).mp32022-08-12 14:13 0  
[SND]beast.mp32022-08-12 14:13 2.6M 
[SND]Maid Dress GR.mp32022-08-12 14:13 0  
[SND]vortex1.mp32022-08-12 14:10 324K 
[SND]Z6.mp32022-08-12 14:06 3.6M 
[SND]Z1.mp32022-08-12 14:06 0  
[SND]tyes.mp32022-08-12 14:05 248K 
[SND]Z5.mp32022-08-12 14:05 4.8M 
[SND]Z4.mp32022-08-12 14:05 3.6M 
[SND]Sannztuy.mp32022-08-12 14:05 1.7M 
[SND]Z3.mp32022-08-12 14:05 2.4M 
[SND]Z2.mp32022-08-12 14:05 4.1M 
[SND]ASIKINbre.mp32022-08-12 14:02 0  
[SND]anton.mp32022-08-12 14:02 344K 
[SND]applee.mp32022-08-12 14:02 0  
[SND]Kesariya.mp32022-08-12 14:01 0  
[SND]Bruno_Mars_-_It_Will_Rain_(Official_Music_Video)(128k).mp32022-08-12 14:00 0  
[SND]Dhijehh.mp32022-08-12 13:59 0  
[SND]thanhak.mp32022-08-12 13:58 0  
[SND]regge.mp32022-08-12 13:58 0  
[SND]santuybngst.mp32022-08-12 13:57 0  
[SND]Ravicks1.mp32022-08-12 13:56 0  
[SND]chifu.mp32022-08-12 13:55 0  
[SND]Ska.mp32022-08-12 13:54 0  
[SND]Ze4.mp32022-08-12 13:54 0  
[SND]Ze6.mp32022-08-12 13:54 0  
[SND]Ze5.mp32022-08-12 13:54 0  
[SND]Ze2.mp32022-08-12 13:53 0  
[SND]KAMPANGGG.mp32022-08-12 13:53 0  
[SND]ZE1.mp32022-08-12 13:53 0  
[SND]ASUI.mp32022-08-12 13:51 0  
[SND]p3.mp32022-08-12 13:46 0  
[SND]Jin_Dogg_街風_feat_REAL_T_Official_Music_Vi.mp32022-08-12 13:44 0  
[SND]gta.mp32022-08-12 13:43 136K 
[SND]astrea redux - timemachine [audiovk.com].mp32022-08-12 13:43 0  
[SND]A8.mp32022-08-12 13:42 0  
[SND]marcin_przybyowicz_-_a_story_you_wont_believe_(z2.fm).mp32022-08-12 13:39 0  
[SND]PANTEK.mp32022-08-12 13:38 0  
[VID]25145f62246bde9491eca32dde3e42dc.mp42022-08-12 13:37 0  
[SND]Caham.mp32022-08-12 13:36 0  
[SND]dj13.mp32022-08-12 13:36 0  
[SND]ASUII.mp32022-08-12 13:35 0  
[SND]andrewsad.mp32022-08-12 13:28 0  
[SND]toto.mp32022-08-12 13:26 3.0M 
[SND]X2Download.com - Versi koplo Viral TikTok Okey Are you Ready lagu Thailand wong e e e e e wong e e e e e (128 kbps).mp32022-08-12 13:26 3.7M 
[SND]za3im.mp32022-08-12 13:25 2.9M 
[SND]Geoxor_-_Aurora_(Byfet.com).mp32022-08-12 13:24 0  
[SND]Y0VNG ZXR0 - Yandere ft. Ambi (Prod. Bughvvl)-1.mp32022-08-12 13:24 0  
[SND]YUNG-RARE _ KXLLSWXTCH ☢️ - TALIBAN DEADBEATVILLAIN.mp32022-08-12 13:23 0  
[SND]Lyova_Vlax_-_A_edet_katitsya_zanijena_priora.mp32022-08-12 13:22 0  
[SND]Pop Smoke - Get Back (mp3store.cc).mp32022-08-12 13:21 0  
[SND]Skirii1.mp32022-08-12 13:18 0  
[SND]vortex.mp32022-08-12 13:17 0  
[SND]GeorgeM1.mp32022-08-12 13:17 0  
[SND]POROJO.mp32022-08-12 13:14 0  
[SND]Galauu18.mp32022-08-12 13:14 0  
[SND]Dennz.mp32022-08-12 13:13 0  
[SND]DAY DAY.mp32022-08-12 13:13 0  
[SND]Pop Smoke - Get Back.mp32022-08-12 13:09 0  
[SND]$uicideboy$ - Fuck Boy Blood Bath.mp32022-08-12 13:06 0  
[SND]Chinx (OS) - Secrets Not Safe.mp32022-08-12 13:05 0  
[SND]Ssinar.mp32022-08-12 13:02 0  
[SND]intheend.mp32022-08-12 13:01 0  
[SND]Sinar.mp32022-08-12 13:01 0  
[SND]DJ GODZILLA V2 SLOW REMIX viral FYP tiktok 2022🎶🎧.mp32022-08-12 12:59 0  
[SND]bodiev-kruzak-200-remix.mp32022-08-12 12:58 0  
[SND]Beach Bunny - Prom Queen (Speed Up) lyrics 🎶.mp32022-08-12 12:56 0  
[SND]1..mp32022-08-12 12:56 0  
[SND]psovsk.mp32022-08-12 12:55 0  
[SND]Kandas15.mp32022-08-12 12:51 0  
[SND]ai_papai.mp32022-08-12 12:50 0  
[SND]Pesnya_Moj_drug_ms_bombil_tolko_legalno.mp32022-08-12 12:49 0  
[SND]Thinkdi.mp32022-08-12 12:46 0  
[SND]Shincan.mp32022-08-12 12:46 0  
[SND]until faond.mp32022-08-12 12:45 0  
[SND]oky.mp32022-08-12 12:38 0  
[SND]dan.mp32022-08-12 12:34 0  
[SND]kane.mp32022-08-12 12:33 2.8M 
[SND]akankah.mp32022-08-12 12:32 0  
[SND]y2mate.com - Romantic Happy Birthday Arranged by Miranda Wong Piano Cover.mp32022-08-12 12:30 0  
[SND]A_cyplenok_pi-pi-piu_-_A_u_nas_zhivet_cyplenok_(iPleer.com).mp32022-08-12 12:26 0  
[SND]Ghostemane - Bonesaw.mp32022-08-12 12:23 0  
[SND]vikram.mp32022-08-12 12:22 2.3M 
[SND]iop.mp32022-08-12 12:22 0  
[SND]kal.mp32022-08-12 12:19 0  
[SND]zxc.mp32022-08-12 12:17 728K 
[SND]omda2.mp32022-08-12 12:15 628K 
[SND]fivem.mp32022-08-12 12:13 92K 
[SND]V-$-XV-PRiNCE_De_Lacure-Jyrigimdi.mp32022-08-12 12:02 1.3M 
[SND]memay.mp32022-08-12 12:01 0  
[SND]DhikaSad8.MP.mp32022-08-12 12:01 0  
[SND]Dhikaa8.mp32022-08-12 12:01 0  
[SND]Dhikaa3.mp32022-08-12 12:00 0  
[SND]Dhikaa2.mp32022-08-12 12:00 4.0M 
[SND]Dhikaa5.mp32022-08-12 12:00 0  
[SND]Dhikaa7.mp32022-08-12 12:00 0  
[SND]god.mp32022-08-12 11:59 16K 
[SND]V $ X V PRiNCE, De Lacure - Жүрегімді.mp32022-08-12 11:57 0  
[SND]BO.mp32022-08-12 11:57 0  
[SND]Bakr_-_Status_dushi_73037819.mp32022-08-12 11:53 6.9M 
[SND]KO.mp32022-08-12 11:53 1.1M 
[SND]Mahika.mp3.mp32022-08-12 11:50 2.5M 
[SND]MO.mp32022-08-12 11:50 4.6M 
[SND]sex.mp32022-08-12 11:49 1.8M 
[SND]TVアニメ『サクラクエスト』ノンクレジットOP/「Morning Glory」(K)NoW_NAME.mp32022-08-12 11:48 0  
[SND]omda3.mp32022-08-12 11:43 1.7M 
[SND]KIRYa_NASVAEV_Matiz.mp32022-08-12 11:42 1.1M 
[SND]loveuna.mp32022-08-12 11:41 0  
[SND]y2mate.com - Rizkyfebian Selamat Ulang tahun Lyrics.mp32022-08-12 11:36 0  
[SND]odium.mp32022-08-12 11:36 0  
[SND]km.mp32022-08-12 11:35 2.4M 
[SND]lop.mp32022-08-12 11:34 0  
[SND]______.mp32022-08-12 11:31 0  
[SND]Pik - Güzelsin (Turkish Trap)333.mp32022-08-12 11:30 0  
[SND]Shincandj.mp32022-08-12 11:30 0  
[SND]Dr.Fresch_ Mina Knock _-_ Feedback_ -_ Feedback1.mp32022-08-12 11:26 0  
[SND]FreigrabeImpuls (DJ Cannabis Coffeeshops Deutschland).mp32022-08-12 11:25 0  
[SND]Kopikap2.mp32022-08-12 11:23 0  
[SND]Dhije.mp32022-08-12 11:18 3.3M 
[SND]Thinkdick.mp32022-08-12 11:18 0  
[SND]GREEY5.mp32022-08-12 11:17 0  
[SND]GREEY6.mp32022-08-12 11:17 0  
[SND]GREEY3.mp32022-08-12 11:17 0  
[SND]GREEY4.mp32022-08-12 11:17 0  
[SND]GREEY2.mp32022-08-12 11:17 0  
[SND]GREEY1.mp32022-08-12 11:16 0  
[SND]shesgone .mp32022-08-12 11:16 0  
[SND]Dj sikok bagi duo.mp32022-08-12 11:15 0  
[SND]Old Love - Yuji _ Putri Dahlia.mp32022-08-12 11:13 0  
[SND]dingdut1.mp32022-08-12 11:11 0  
[SND]DhikaSad (1).mp32022-08-12 11:05 1.2M 
[SND]ilham11.mp32022-08-12 11:03 1.9M 
[SND]wtf.mp32022-08-12 11:03 1.6M 
[SND]Myz1.mp32022-08-12 10:58 0  
[SND]selebew.mp32022-08-12 10:57 0  
[SND]M.I.B - Jak (Official MV).mp32022-08-12 10:54 0  
[SND]Marshi I UÇK (Albanian War Song).mp32022-08-12 10:48 0  
[SND]omda1.mp32022-08-12 10:47 0  
[SND]instasamka-moneyken-love-speed-up.mp32022-08-12 10:45 0  
[SND]King of Doowhite - Maiyarap ft.Repaze [Official MV].mp32022-08-12 10:44 0  
[SND]sova-pesni-staryh-kasset.mp32022-08-12 10:42 0  
[SND]chillbuon1199.mp32022-08-12 10:41 0  
[SND]VY.mp32022-08-12 10:39 0  
[SND]Баллада о забытом мире.mp32022-08-12 10:39 212K 
[SND]white_NH4XfTU.mp32022-08-12 10:37 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0whlYJAI.mp32022-08-12 10:36 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616-dgtx5sbw_0Njc72gq.mp32022-08-12 10:35 0  
[SND]nhacthattinh1129.mp32022-08-12 10:35 0  
[SND]ajimat.mp32022-08-12 10:35 916K 
[SND]chpunk-edison-ochko.mp32022-08-12 10:35 0  
[SND]not-for-sale-fossil-kanon-wakeshima-4786337666483773616_DGtX5sbw.mp32022-08-12 10:27 0  
[SND]pesnya-ya-mazhu-vazelinom.mp32022-08-12 10:21 0  
[SND]dajte-tank-besy_(mp3IQ.net).mp32022-08-12 10:18 0  
[SND]alpin.mp32022-08-12 10:16 0  
[SND]k111.mp32022-08-12 10:15 0  
[SND]They.mp32022-08-12 10:13 0  
[SND]Аквариум - 212-85-06 (OST ПитерFM).mp32022-08-12 10:11 6.5M 
[SND]Dajjte_tank_-_Besy_(musmore.com).mp32022-08-12 10:11 0  
[SND]zxcursedkillua.mp3.mp32022-08-12 10:10 0  
[SND]s99.mp32022-08-12 10:10 0  
[SND]darr1.mp32022-08-12 10:09 0  
[SND]rexx.mp32022-08-12 10:09 0  
[SND]zxcursedKillua (2).mp32022-08-12 10:06 0  
[SND]zxcursedkillua.mp32022-08-12 10:05 0  
[SND]dar1.mp32022-08-12 10:04 0  
[SND]audiomsg_641244583.mp32022-08-12 10:04 0  
[SND]imagelinefixyourshittyprogram.mp32022-08-12 10:03 0  
[SND]DANY8081.mp32022-08-12 10:00 0  
[SND]darar1.mp32022-08-12 10:00 0  
[SND]The.mp32022-08-12 09:59 104K 
[SND]Falmengkane11.mp32022-08-12 09:59 0  
[SND]yahah.mp32022-08-12 09:55 0  
[SND]The Yes Yes Show - Francis M & Parokya Ni Edgar.mp32022-08-12 09:52 0  
[SND]y2mate.com - DJ KANDAS DANGDUT DJ KANDAS JEDAG JEDUG SLOW FULL BASS VIRAL FYP TIK TOK 2022.mp32022-08-12 09:51 0  
[SND]GREYGODS[ConverteZilla.com].mp32022-08-12 09:51 0  
[SND]zxcursed_Killua.mp32022-08-12 09:51 0  
[SND]sunroof.mp32022-08-12 09:50 2.7M 
[SND]k6.mp32022-08-12 09:49 1.9M 
[SND]k5.mp32022-08-12 09:48 7.7M 
[SND]zxcursed_-_killua_74293338.mp32022-08-12 09:45 0  
[SND]GARUDA.mp32022-08-12 09:43 0  
[SND]Klava_Bravo_Nazyvaj_menya_trener_remiks.mp32022-08-12 09:42 2.1M 
[SND]k3.mp32022-08-12 09:41 3.1M 
[SND]fridaynight.mp32022-08-12 09:38 3.2M 
[SND]Djenak.mp32022-08-12 09:36 4.0M 
[SND]XD5.mp32022-08-12 09:33 0  
[SND]shadowraze_-_Shadow_Fiend_73331416.mp32022-08-12 09:33 0  
[SND]shadowfiend_feat_perfect_player_-_shadowraze_71630335.mp32022-08-12 09:33 0  
[SND]joy100.mp32022-08-12 09:32 0  
[SND]XD4.mp32022-08-12 09:30 0  
[SND]shadowraze_-_juggernaut_Prod_by_PLVSTIC_Prod_by_PLVSTIC_73220345.mp32022-08-12 09:26 0  
[SND]rakhim_20_-_21.mp32022-08-12 09:26 0  
[SND]Shadowraze_babyswishh1_-_psiblades_73220334 (1).mp32022-08-12 09:26 0  
[SND]XD3.mp32022-08-12 09:24 0  
[SND]XD2.mp32022-08-12 09:24 0  
[SND]XD6.mp32022-08-12 09:24 0  
[SND]rakhim_20-21.mp32022-08-12 09:24 0  
[SND]zxcursed_-_never_enough_74046259.mp32022-08-12 09:24 0  
[SND]XD1.mp32022-08-12 09:21 0  
[SND]nelsen.mp32022-08-12 09:14 0  
[SND]rakhim_20-20.mp32022-08-12 09:06 5.2M 
[SND]mikedingin.mp32022-08-12 09:03 4.5M 
[SND]BAKAR.mp32022-08-12 09:03 4.2M 
[SND]ER.mp32022-08-12 09:02 3.6M 
[SND]rakhim_20_20.mp32022-08-12 09:01 0  
[SND]mike2.mp32022-08-12 08:57 0  
[SND]xvx.mp32022-08-12 08:54 0  
[SND]sepka.mp32022-08-12 08:47 0  
[SND]shen.mp32022-08-12 08:45 0  
[SND]xa.mp32022-08-12 08:44 3.8M 
[SND]tothebone.mp32022-08-12 08:42 2.0M 
[SND]beautyandbeat.mp32022-08-12 08:38 0  
[SND]Xybca5.mp32022-08-12 08:37 0  
[SND]Sektor_Gaza_-_Kolkhoznyjj_pank_48646528.mp32022-08-12 08:33 0  
[SND]cigar.mp32022-08-12 08:30 0  
[SND]Sergejj_Zavyalov_-_Ty_dlya_menya_odna_62331592.mp32022-08-12 08:30 0  
[SND]BOJO.mp32022-08-12 08:21 0  
[SND]ANJ.mp32022-08-12 08:20 0  
[SND]SOUND JJ ZERSOFBOY.mp32022-08-12 08:19 0  
[SND]anditox.mp32022-08-12 08:17 0  
[SND]vv.mp32022-08-12 08:16 200K 
[SND]Cardi_B_Megan_Thee_Stallion_-_WAP_70519836.mp32022-08-12 08:16 0  
[SND]BOBOLE.mp32022-08-12 08:16 0  
[SND]casablanca.mp32022-08-12 08:15 256K 
[SND]luce4.mp32022-08-12 08:14 0  
[SND]gehoy.mp32022-08-12 08:11 0  
[SND]ww.mp32022-08-12 08:11 2.8M 
[SND]ayana.mp32022-08-12 08:09 0  
[SND]comeonradio.mp32022-08-12 08:07 0  
[SND]SnapTik_7051841172783910170.mp32022-08-12 08:06 0  
[SND]Mobb Deep - Shook Ones, Pt. II (Official HD Video).mp32022-08-12 08:05 0  
[SND]ComeInside3.mp32022-08-12 08:03 0  
[SND]OOR3.mp32022-08-12 08:02 1.8M 
[SND]Decade1.mp32022-08-12 07:58 0  
[SND]DJBABA.mp32022-08-12 07:57 0  
[SND]A05.mp32022-08-12 07:56 0  
[SND]A04.mp32022-08-12 07:56 0  
[SND]A03.mp32022-08-12 07:55 0  
[SND]A02.mp32022-08-12 07:55 0  
[SND]Yang Peng - Long Night Journey.mp32022-08-12 07:55 0  
[SND]Just Friends - Pee Wee Gaskins Instrument (minus one karoke version, no vocal) lyric.mp32022-08-12 07:54 0  
[SND]OOR2.mp32022-08-12 07:53 0  
[SND]Aarne feat. Big Baby Tape - Ski Ski (2).mp32022-08-12 07:46 0  
[SND]RdP12.mp32022-08-12 07:44 0  
[SND]TULUS-Monokrom-Official-Music-Video_QqJ-Vp8mvbk.mp32022-08-12 07:43 0  
[SND]Decade9.mp32022-08-12 07:40 0  
[SND]fivem3.mp32022-08-12 07:36 0  
[SND]OOR1.mp32022-08-12 07:36 0  
[SND]Sugaldo Ganteng.mp32022-08-12 07:36 0  
[SND]on.mp32022-08-12 07:32 2.4M 
[SND]ALX.mp32022-08-12 07:27 0  
[SND]Zv1.mp32022-08-12 07:26 0  
[SND]bp-du2.mp32022-08-12 07:25 0  
[SND]bp-du.mp32022-08-12 07:22 0  
[SND]shadowraze.mp32022-08-12 07:22 4.6M 
[SND]rc.mp32022-08-12 07:17 0  
[SND]Modern Talking — Cheri Cheri Lady.mp32022-08-12 07:17 0  
[SND]Мурат Тхагалегов - За тебя Калым отдам.mp32022-08-12 07:17 208K 
[SND]Binibirocha.mp32022-08-12 07:14 3.2M 
[SND]INSTASAMKA – MONEYKEN LOVE prod realmoneyken.mp32022-08-12 07:13 0  
[SND]RV.mp32022-08-12 07:10 0  
[SND]rv-fmr1.mp32022-08-12 07:06 0  
[SND]MESSII.mp32022-08-12 07:03 0  
[SND]rv-fmr.mp32022-08-12 06:58 0  
[SND]dr-dre-deep-cover-feat-snoop-dogg.mp32022-08-12 06:55 9.8M 
[VID]Tan2.mp42022-08-12 06:55 0  
[SND]Freddie Dredd - All Alone.mp32022-08-12 06:55 0  
[SND]snoop-dogg-dr-dre-deep-cover-uncensored.mp32022-08-12 06:54 0  
[SND]Dr. Dre - Deep Cover (feat. Snoop Dogg) (mp3store.cc).mp32022-08-12 06:53 0  
[SND]instasamka-moya-kiska-dlya-nego-vsegda-gotova.mp32022-08-12 06:53 0  
[SND]Psych - 9 Мая [Рэп-Столица]_(tiktok-pesni.com).mp32022-08-12 06:50 0  
[VID]tan.mp42022-08-12 06:47 408K 
[SND]aespa-lts.mp32022-08-12 06:45 2.9M 
[SND]BORNEO.mp32022-08-12 06:43 8.0M 
[SND]ikmal.mp32022-08-12 06:39 278K 
[SND]hejoboys.mp32022-08-12 06:36 0  
[SND]N3.mp32022-08-12 06:35 0  
[SND]N2.mp32022-08-12 06:34 0  
[SND]akamsi.mp32022-08-12 06:32 0  
[SND]N1.mp32022-08-12 06:32 0  
[SND]あれくん Alekun「ずるいよ、、、」Zurui yo _Lyrics.mp32022-08-12 06:24 0  
[SND]#Lyric WEST MELANESIA.mp32022-08-12 06:23 0  
[SND]y2mate.com - GUYONWATON OFFICIAL SEBATAS TEMAN OFFICIAL LYRIC VIDEO.mp32022-08-12 06:23 0  
[SND]sound.mp32022-08-12 06:21 0  
[SND]jah-khalib-guf-na-svoyom-vajbe-mp3.mp32022-08-12 06:18 0  
[SND]Jah Khalib _ Guf - На Своём Vibe.mp32022-08-12 06:17 0  
[SND]Mario Zwinkle X Keilandboi - Heavy In The Game INSTRUMENTAL.mp32022-08-12 06:17 0  
[SND]Пошлая Молли - Нон стоп.mp32022-08-12 06:16 0  
[SND]bagiduo.mp32022-08-12 06:07 4.3M 
[SND]gtw.mp32022-08-12 05:58 0  
[SND]Dj.mp32022-08-12 05:56 0  
[SND]nicaplaylist.mp32022-08-12 05:52 0  
[SND]mabukcinta.mp32022-08-12 05:50 0  
[SND]SANS.mp32022-08-12 05:50 0  
[SND]Ezra7.mp32022-08-12 05:49 0  
[SND]SKIN.mp32022-08-12 05:48 0  
[SND]LL.mp32022-08-12 05:46 2.8M 
[SND]Wolve.mp32022-08-12 05:46 0  
[SND]Честный - Мама.mp32022-08-12 05:45 0  
[SND]Glooco2.mp32022-08-12 05:42 1.6M 
[SND]Glooco1.mp32022-08-12 05:41 467K 
[SND]DhikaSad.mp32022-08-12 05:40 0  
[SND]DEYO.mp32022-08-12 05:38 184K 
[SND]kkk.mp32022-08-12 05:37 2.2M 
[SND]plume.mp32022-08-12 05:36 0  
[SND]XNCX.mp32022-08-12 05:33 52K 
[SND]mp13.mp32022-08-12 05:32 4.2M 
[SND]plenka_-_Call_Me_(Slowed).mp32022-08-12 05:28 6.2M 
[SND]prodby668_-_prolly_my_spookiest_beat_sped_up_73964471.mp32022-08-12 05:27 0  
[SND]Lemon_Demon_-_Touch-Tone_Telephone_69649037.mp32022-08-12 05:26 0  
[SND]WESTLBRTY'S - SAN-FIERRO.mp32022-08-12 05:26 0  
[SND]sss.mp32022-08-12 05:18 3.0M 
[SND]friendcity1.mp32022-08-12 05:18 0  
[SND]pasoori.mp32022-08-12 05:15 3.6M 
[SND]friends1.mp32022-08-12 05:15 0  
[SND]friends2.mp32022-08-12 05:14 0  
[SND]Norin.mp32022-08-12 05:14 880K 
[SND]friend1.mp32022-08-12 05:11 0  
[SND]frend1.mp32022-08-12 05:09 0  
[SND]da.mp32022-08-12 05:07 3.1M 
[SND]aku selalu bahagia.mp32022-08-12 05:06 0  
[SND]หูไม่ตรงกับตา.mp32022-08-12 05:06 0  
[SND]WE_NEVER_DIE_-_BROKER_NEIRP_ANTHEM_OFFICIAL_AUDIO_(Prod.By_Rifky_Arizaldy)(128k).mp32022-08-12 05:04 3.0M 
[SND]ck.mp32022-08-12 05:01 0  
[SND]friend-1.mp32022-08-12 05:01 0  
[SND]4WHEEL_-_KERAUNOS_KILLER_73336472.mp32022-08-12 05:01 0  
[SND]Psyco M - Plume-Psyco-M.mp32022-08-12 04:44 0  
[SND]Party.mp32022-08-12 04:35 0  
[SND]Journey_-_Separate_Ways_Worlds_Apa_(getmp3.pro).mp32022-08-12 04:31 0  
[SND]Endank.mp32022-08-12 04:27 0  
[SND]Bungul3.mp32022-08-12 04:27 0  
[SND]Bungul4.mp32022-08-12 04:27 0  
[SND]who.mp32022-08-12 04:22 0  
[SND]bck.mp32022-08-12 04:22 0  
[SND]CL.mp32022-08-12 04:17 0  
[SND]milisikecoa.mp32022-08-12 04:12 0  
[SND]PERFECTCHRISTMAS.mp32022-08-12 04:04 0  
[SND]tklove.mp32022-08-12 03:33 0  
[SND]徐佳莹&阿爆&Brandy-切歌 feat. ABAO阿爆&Brandy.mp32022-08-12 03:32 0  
[SND]Azari_-_Nightmare_(musmore.com).mp32022-08-12 03:28 0  
[SND]hot60.mp32022-08-12 03:20 0  
[SND]y2mate.com - DJ TELOLET X RINDU SEMALAM SLOW Viral Di Fyp TikTok.mp32022-08-12 03:20 0  
[SND]rap100.mp32022-08-12 03:14 0  
[SND]p2.mp32022-08-12 03:10 536K 
[SND]bangbang.mp32022-08-12 03:06 0  
[SND](26,29,35,40hz)Need for Speed - Get Low(Screwed by Gorilla_Bass).mp32022-08-12 03:04 0  
[SND]Dissah Dzu - Uatnek 21.mp32022-08-12 02:58 0  
[SND]BODIEV - Между девятин.mp32022-08-12 02:58 0  
[SND]77-й'. - .mp32022-08-12 02:58 0  
[SND]1-❤ - качает`.mp32022-08-12 02:58 2.0M 
[SND]p1.mp32022-08-12 02:47 214K 
[SND]Ben3.mp32022-08-12 02:36 0  
[SND]WestBarrio.mp32022-08-12 02:29 0  
[SND]Takbo.mp32022-08-12 02:29 0  
[SND]BCFL.mp32022-08-12 02:29 0  
[SND]Pagmamahal.mp32022-08-12 02:28 0  
[SND]OneOfTheseDays.mp32022-08-12 02:28 0  
[SND]bang3.mp32022-08-12 02:24 0  
[SND]andika1.mp32022-08-12 02:09 0  
[SND]AjimatMG.mp32022-08-12 02:08 0  
[SND]hatepok1.mp32022-08-12 02:08 0  
[SND]SAY.mp32022-08-12 02:07 0  
[SND]How.mp32022-08-12 02:07 0  
[SND]NOTHING.mp32022-08-12 02:07 3.8M 
[SND]Never.mp32022-08-12 02:07 3.2M 
[SND]FOREVER.mp32022-08-12 02:07 0  
[SND]Thewill.mp32022-08-12 02:07 0  
[SND]EXCHANGE.mp32022-08-12 02:07 0  
[SND]KLM.mp32022-08-12 02:07 0  
[SND]andika1.m4a2022-08-12 02:02 0  
[SND]Jewish Princess.mp32022-08-12 02:00 0  
[SND]xwan39.mp32022-08-12 01:59 0  
[SND]xwan40.mp32022-08-12 01:58 0  
[SND]xwan41.mp32022-08-12 01:58 0  
[SND]Y2Mate.is - Round Change - Shadows of Evil - Soundtrack-OGYa9IrOf9s-160k-1660269164390.mp32022-08-12 01:54 0  
[SND]np6.mp32022-08-12 01:54 0  
[SND]np5.mp32022-08-12 01:54 0  
[SND]np4.mp32022-08-12 01:53 0  
[SND]np3.mp32022-08-12 01:53 0  
[SND]Pagsamo.mp32022-08-12 01:53 4.4M 
[SND]Say.mp32022-08-12 01:53 0  
[SND]Mapa.mp32022-08-12 01:53 2.2M 
[SND]NOBITA.mp32022-08-12 01:53 0  
[SND]the will.mp32022-08-12 01:53 0  
[SND]Binibini.mp32022-08-12 01:53 0  
[SND]np2.mp32022-08-12 01:53 0  
[SND]Exchange.mp32022-08-12 01:53 0  
[SND]np1.mp32022-08-12 01:53 0  
[SND]tarik1.mp32022-08-12 01:52 3.3M 
[SND]M.T.G - (Only Fans feat. No1-NOAH .mp32022-08-12 01:51 0  
[SND]Forevermore.mp32022-08-12 01:47 812K 
[SND]TheFinal.mp32022-08-12 01:42 0  
[SND]Vendredi13Août2021.mp32022-08-12 01:26 0  
[SND]Dw1.mp32022-08-12 01:26 80K 
[SND]Dw3.mp32022-08-12 01:26 0  
[SND]Dw2.mp32022-08-12 01:26 0  
[SND]Dw5.mp32022-08-12 01:26 1.6M 
[SND]lagu1.mp32022-08-12 01:24 1.1M 
[SND]Afgan - Jodoh Pasti Bertemu Official Video Clip.mp32022-08-12 01:23 0  
[SND]On The Floor - Jennifer Lopez.mp32022-08-12 01:22 5.7M 
[SND]Kesariya (From Brahmastra) - Pritam.mp32022-08-12 01:22 4.1M 
[SND]Hookah Bar (LoFi) - Shubham Rangra.mp32022-08-12 01:22 4.4M 
[SND]Sodakku_From_Thaanaa_Serndha_Koottam_Anirudh_Ravichander.mp32022-08-12 01:22 3.7M 
[SND]Azhalinte_Azhangalil_From_Ayalum_Njanum_Thammil_Male_Vocals_Nikhil.mp32022-08-12 01:22 5.2M 
[SND]Kudukku - Vineeth Sreenivasan.mp32022-08-12 01:21 2.4M 
[SND]mn.mp32022-08-12 01:21 2.4M 
[SND]Project - 8:11:22, 5.59 PM.mp32022-08-12 01:20 0  
[SND]v4.mp32022-08-12 01:19 3.4M 
[SND]Vicks1.mp32022-08-12 01:18 1.3M 
[SND]v5.mp32022-08-12 01:15 388K 
[SND]Jejennie.mp32022-08-12 01:14 0  
[SND]mygang.mp32022-08-12 01:11 0  
[SND]1_4943094942051336640.mp32022-08-12 01:09 0  
[SND]Took Him Too - John Sebby Elliott Sheridan.mp32022-08-12 01:08 0  
[SND]matila.mp32022-08-12 01:06 0  
[SND]Razz1.mp32022-08-12 01:05 0  
[SND]phupu.mp32022-08-12 01:03 0  
[SND]7077114216255064859.mp32022-08-12 00:59 0  
[SND]N1NT3ND0_-_CHP_47965410.mp32022-08-12 00:55 0  
[SND]puresouls7.22.19.mp32022-08-12 00:50 0  
[SND]LILDRUGHILL_MARCO_9_Jet.mp32022-08-12 00:42 0  
[SND]rastaman-ne-nuzhna-mne-korona-princessa-i-gory.mp32022-08-12 00:36 0  
[SND]N1NT3ND0 - ЧП.mp32022-08-12 00:36 0  
[SND]LILDRUGHILL_ROCKET_Terminal.mp32022-08-12 00:35 0  
[SND]Jennie1945.mp32022-08-12 00:32 0  
[SND]Rin Ljubav for life.mp32022-08-12 00:27 0  
[SND]Brayen2.mp32022-08-12 00:17 0  
[SND]Brayen3.mp32022-08-12 00:17 0  
[SND]Brayen5.mp32022-08-12 00:17 0  
[SND]pu.mp32022-08-12 00:16 0  
[SND]Brayen4.mp32022-08-12 00:15 0  
[SND]Brayen1.mp32022-08-12 00:13 0  
[SND]Ytta1.mp32022-08-12 00:11 0  
[SND]Ytta40.mp32022-08-12 00:08 0  
[SND]Phu.mp32022-08-12 00:08 2.5M 
[SND]Gnjr.mp32022-08-12 00:06 2.4M 
[SND]Sbbg.mp32022-08-12 00:05 0  
[SND]Gnjrrmx.mp32022-08-12 00:05 0  
[SND]Abubudu.mp32022-08-11 23:54 0  
[SND]DIBANDINGKE.mp32022-08-11 23:53 3.0M 
[SND]JENNIENATAEL90.mp32022-08-11 23:47 4.5M 
[SND]mood.mp32022-08-11 23:46 2.1M 
[SND]ChippedAx.mp32022-08-11 23:44 0  
[SND]Chipped Ax - Lion Numchok and Joke So Cool (Official MV)(MP3_320K).mp32022-08-11 23:41 0  
[SND] Sabilulungan Trap.mp32022-08-11 23:32 0  
[SND]Genjer Genjer (1).mp32022-08-11 23:30 0  
[SND]genjer genjer remix .mp32022-08-11 23:30 0  
[SND]MAZ_KORZH_-_negry_vse_pidorasy_(iPleer.com).mp32022-08-11 23:21 0  
[SND]DVRST_6YNTHMANE_ANTICXLTXRE_-_Will_Be_Soon_74627715.mp32022-08-11 23:12 0  
[SND]Maz_Korzh_Ya_pomnyu_mazellovvv.mp32022-08-11 23:04 7.1M 
[SND]Apple TV Imp.mp32022-08-11 23:00 0  
[SND]v19.mp32022-08-11 22:58 0  
[SND]v20.mp32022-08-11 22:57 0  
[SND]v18.mp32022-08-11 22:57 0  
[SND]v17.mp32022-08-11 22:56 0  
[SND]yt1s.io - Tshego Morore - Project Geese (2024) (128 kbps)(1).mp32022-08-11 22:54 0  
[SND]Industry Baby sped up is actually fire.mp32022-08-11 22:54 0  
[SND]c3.mp32022-08-11 22:45 3.6M 
[SND]c2.mp32022-08-11 22:45 4.8M 
[SND]index.mp32022-08-11 22:44 98K 
[SND]v15.mp32022-08-11 22:42 0  
[SND]v14.mp32022-08-11 22:30 0  
[SND]v13.mp32022-08-11 22:30 0  
[SND]v12.mp32022-08-11 22:29 0  
[SND]v11.mp32022-08-11 22:29 0  
[SND]v10.mp32022-08-11 22:15 0  
[SND]Bhjt.mp32022-08-11 22:14 0  
[SND]v7.mp32022-08-11 22:14 0  
[SND]v9.mp32022-08-11 22:13 0  
[SND]v8.mp32022-08-11 22:13 0  
[SND]instasamka-lipsi-ha-file.mp32022-08-11 22:08 4.8M 
[SND]Keskin - Raad Yok.mp32022-08-11 22:05 0  
[SND]Mis.m4a2022-08-11 21:57 0  
[SND]PLAZA Installer Music - 2015 - November [bThTHiM8lkM].mp32022-08-11 21:54 0  
[SND]Viral Tiktok..! Dj Remix SIKOK BAGI DUO - Meli __ OT Zarly Dj Dody (320 kbps).mp32022-08-11 21:50 0  
[SND]Shadowraze - Showdown.mp32022-08-11 21:48 0  
[SND]v2.mp32022-08-11 21:46 2.2M 
[SND]v1.mp32022-08-11 21:45 2.3M 
[SND]hfDr3ig2Vd8F.128.mp32022-08-11 21:37 0  
[SND]Acoustic guitar sound effect free download.mp32022-08-11 21:33 0  
[VID]Smack My Bitch Up (2).mp42022-08-11 21:11 0  
[VID]creweskan.mp42022-08-11 21:09 0  
[SND]Суета.mp32022-08-11 21:08 0  
[SND]turi ip ip slowed reverb------ (remake)(MP3_128K).mp32022-08-11 21:06 0  
[SND]Mantra Hujan - Kobo Kanaeru __ Acoustic Version (Lirik _ Lyrics _ TikTok Song)(MP3_160K).mp32022-08-11 21:06 0  
[SND]AMONG US REMIX (VERSI MAMANK GAROX)(MP3_320K).mp32022-08-11 21:05 0  
[SND]darman.mp32022-08-11 21:03 0  
[SND]rom1.mp32022-08-11 20:55 0  
[SND]Escadas - Roll Up.mp32022-08-11 20:48 0  
[SND]sadalex1.mp32022-08-11 20:43 0  
[SND]sgK6p9bqccbnQ1100OySZqOrvNPlW10H.mp32022-08-11 20:40 0  
[SND]TankTrouble (1).mp32022-08-11 20:40 0  
[SND]TankTrouble.mp32022-08-11 20:40 0  
[SND]Depeche Mode - Never Let Me Down Again.mp32022-08-11 20:39 6.9M 
[SND]Secret.mp32022-08-11 20:37 0  
[SND]y2mate.com - Blingos ft EL KATIBA.mp32022-08-11 20:35 0  
[SND]21-Shields-V2.0.mp32022-08-11 20:35 0  
[SND]y2mate.com - Blingos ft EL KATIBA عكس السرب Clip Officiel.mp32022-08-11 20:32 0  
[SND]BO9AL.mp32022-08-11 20:31 0  
[SND]2022-08-11 16-17-23_Trim.mp32022-08-11 20:30 0  
[SND]x.mp32022-08-11 20:30 93K 
[SND]abdo.mp32022-08-11 20:22 308K 
[SND]moro.mp32022-08-11 20:06 0  
[SND]DISCO.mp32022-08-11 19:59 0  
[SND]Kamazz - Как ты там.mp32022-08-11 19:55 0  
[SND]FACE_-_Biznes_72861005.mp32022-08-11 19:54 0  
[SND]Gay.mp32022-08-11 19:50 0  
[SND]Rollo Tomassi - L'homme rationnel .mp32022-08-11 19:48 0  
[VID]Rollo Tomassi - L'homme rationnel .mp42022-08-11 19:48 0  
[SND]JE.mp32022-08-11 19:47 0  
[SND]Suwy.mp32022-08-11 19:44 0  
[SND]AsianF.mp32022-08-11 19:43 0  
[SND]grey1.mp32022-08-11 19:42 0  
[SND]CH.mp32022-08-11 19:40 112K 
[SND]badang.mp32022-08-11 19:40 0  
[VID]lv_0_20220804225837.mp42022-08-11 19:39 0  
[SND]MiyaGi & Andy Panda - Minor.mp32022-08-11 19:35 0  
[SND]EdwardBil_Psikhopt.mp32022-08-11 19:33 0  
[SND]LD.mp32022-08-11 19:32 0  
[SND]ФОНК - phonk (mp3-2020.com).mp32022-08-11 19:31 0  
[SND]cartoon-jump-6462.mp32022-08-11 19:31 0  
[SND]X2Download.com - ใจร้าย - ILLSLICK _ Cover By.Seen ft.Miguel (ฺBadguy) (128 kbps).mp32022-08-11 19:28 424K 
[SND]Jonyy2.mp32022-08-11 19:18 0  
[SND]isolate.exe - crystals __ slowed + reverb.mp32022-08-11 19:11 0  
[SND]yatz2.mp32022-08-11 19:03 3.6M 
[SND]s6.mp32022-08-11 19:01 2.5M 
[SND]mike1.mp32022-08-11 19:00 2.9M 
[SND]sample.mp32022-08-11 18:59 0  
[SND]Middle.mp32022-08-11 18:57 0  
[SND]CONSTANT.mp32022-08-11 18:56 0  
[SND]Dahan.mp32022-08-11 18:56 3.3M 
[SND]The Kiffness X Big Billy (Live Looping Talking Cat Remix).mp32022-08-11 18:56 0  
[SND]SnapSave.io - เหลือแค่ส้วมที่ใช้ร่วมกัน (128 kbps).mp32022-08-11 18:53 0  
[SND]moan.mp32022-08-11 18:53 3.1M 
[SND]Big Poppa Extreme Bass Boosted.mp32022-08-11 18:52 0  
[SND]rakhim-sinij-lamborghini-mp3.mp32022-08-11 18:48 0  
[SND]เหลือแค่ส้วมที่ใช้ร่วมกัน.mp32022-08-11 18:45 0  
[SND]Keizaro6.mp32022-08-11 18:40 4.0M 
[SND]yatz3.mp32022-08-11 18:39 3.2M 
[SND]coffe.mp32022-08-11 18:29 0  
[SND]10 - Skinheads S.H..mp32022-08-11 18:20 172K 
[SND]dgdsgdf.mp32022-08-11 18:14 0  
[SND]Учения безмолвного ума. (320 kbps).mp32022-08-11 18:10 0  
[SND]Last_Stop.mp32022-08-11 18:09 0  
[SND]My-Everything_HxWSDUC-KTU.mp32022-08-11 18:05 0  
[SND]jony.mp32022-08-11 18:04 0  
[SND]Dhyo_-_Haw__Jarak_Dan_Kita___lagu_terbaru.mp32022-08-11 18:01 0  
[SND]ikeh1.mp32022-08-11 18:00 0  
[SND]senyum.mp32022-08-11 18:00 3.1M 
[SND]Campfire Crackling warm cozy beats.mp32022-08-11 17:59 0  
[SND]jony1.mp32022-08-11 17:59 0  
[SND]y2mate.com - EVAN LOSS FULL SENYUM SAYANG.mp32022-08-11 17:58 0  
[SND]thrill_pill_polnoch.mp32022-08-11 17:56 0  
[SND]keren.mp32022-08-11 17:48 2.6M 
[VID]4eb407f96ba5febdfecc87d5f4cc4125.mp42022-08-11 17:48 0  
[SND]Ajs_Nigrutin_Kilo_Granja_Lesim.mp32022-08-11 17:47 0  
[SND]DJ Reggae Come On Come On Turn The Radio X Sampe Bawah Fyp TikTok• Jaranan Dor • Alfin Revolution.mp32022-08-11 17:47 0  
[SND]DJ AMERICAN DREAMS X MELODY MENGKANE VIRAL TIKTOK.mp32022-08-11 17:44 0  
[SND]19wmnsgsuakakan.mp32022-08-11 17:44 0  
[SND]Farruko - Pepas.mp32022-08-11 17:43 0  
[SND]farruko-pepas.mp32022-08-11 17:40 0  
[SND][mileon] - L устал.mp32022-08-11 17:38 0  
[SND]Skriptonit_-_Mister_718_51836708.mp32022-08-11 17:34 0  
[SND]dj3.mp32022-08-11 17:32 3.4M 
[SND][EldarwaR] - II - Die Lösung.mp32022-08-11 17:29 0  
[SND]escltplayer8181818.mp32022-08-11 17:26 0  
[SND]GTA.mp32022-08-11 17:17 2.5M 
[SND]theyn.mp32022-08-11 17:16 0  
[VID]SnapInsta_280653172_1075198643075739_7338141745345842817_n.mp42022-08-11 17:15 0  
[SND]Y2Mate.is - Chad sound affect-gLeydZjRwtE-48k-1660238121260.mp32022-08-11 17:15 0  
[SND]payt1.mp32022-08-11 17:15 0  
[SND]payt.mp32022-08-11 17:15 0  
[SND]escltplayer.mp32022-08-11 17:14 0  
[SND]singto.mp32022-08-11 17:09 0  
[SND]videoplayback.m4a2022-08-11 17:09 0  
[SND]ardy03.mp32022-08-11 17:09 0  
[SND]ardy02.mp32022-08-11 17:08 0  
[SND]144.mp32022-08-11 17:08 2.4M 
[SND]ardy01.mp32022-08-11 17:07 0  
[SND]199.mp32022-08-11 17:06 0  
[VID]Y2Mate.is - Batman Beatbox-ApMzw-tyHmg-720p-1660236001700 (1).mp42022-08-11 17:01 0  
[SND]jian25.mp32022-08-11 17:01 0  
[SND]jian8.mp32022-08-11 17:01 0  
[SND]forum_-_belaya-noch.mp32022-08-11 16:56 0  
[SND]tumsath.mp32022-08-11 16:51 0  
[SND]J_Balvin_Skrillex_-_In_Da_Getto_73025728.mp32022-08-11 16:49 0  
[SND]Randa2.mp32022-08-11 16:48 0  
[SND]Zack0.mp32022-08-11 16:47 0  
[SND]chippedax2.mp32022-08-11 16:46 0  
[SND]chippedax122.mp32022-08-11 16:41 0  
[SND]Wangy1.mp32022-08-11 16:41 0  
[SND]Randa4.mp32022-08-11 16:39 0  
[SND]DhemDJ11.mp32022-08-11 16:37 0  
[SND]Нагыз Казактын - Шешен амы (radio.lol).mp32022-08-11 16:35 0  
[SND]chippedax.mp32022-08-11 16:33 0  
[SND]Junko Yagami - Bay City (Extended Disco Mix) (www.hotplayer.ru).mp32022-08-11 16:33 0  
[SND]こんにちは、サルカズ傭兵のハナです.m4a2022-08-11 16:31 0  
[SND]ik100.mp32022-08-11 16:22 0  
[SND]Big_Baby_Tape_Molodoj_Platon_VLYuBILAS.mp32022-08-11 16:22 0  
[SND]ardyFNF.mp32022-08-11 16:19 0  
[SND]kayganda.mp32022-08-11 16:13 0  
[SND]Ghost_Mary_On_A_Cross.mp32022-08-11 16:10 0  
[SND]kamalayan.mp32022-08-11 16:10 2.9M 
[SND]Jaydee123.mp32022-08-11 16:08 0  
[SND]matanda.mp32022-08-11 16:07 0  
[SND]lukku.mp32022-08-11 16:07 0  
[SND]Njan Jackson Allada DJ Remix _ DJ Strawz _ Soubin(MP3_70K).mp32022-08-11 16:07 716K 
[SND]st7.mp32022-08-11 16:05 0  
[SND]FNF.mp32022-08-11 16:01 0  
[SND]thrill-pill-polnoch.mp32022-08-11 15:55 0  
[SND]Jroa.mp32022-08-11 15:55 0  
[SND]KAMENRIDER.mp32022-08-11 15:53 0  
[SND]JennieNatael1.mp32022-08-11 15:53 0  
[SND]fancyadamvanhammerslicemenice.mp32022-08-11 15:53 0  
[SND]chdn.mp32022-08-11 15:51 0  
[SND]JEN.mp32022-08-11 15:48 0  
[SND]AMMU.mp32022-08-11 15:37 0  
[SND]Herocashcash.mp32022-08-11 15:34 376K 
[SND]dhije2.mp32022-08-11 15:34 3.4M 
[SND]bgm1vmrp.mp32022-08-11 15:30 348K 
[SND]Sample-audio-demo.mp32022-08-11 15:29 0  
[SND]JIMIN (BTS) & HA SUNG WOON - With You (OST Our Blues Part.4) [320 kbps].mp32022-08-11 15:28 0  
[SND]505.mp32022-08-11 15:28 576K 
[SND]9999.mp32022-08-11 15:26 0  
[SND]Reyy2.mp32022-08-11 15:20 0  
[SND]55.mp32022-08-11 15:17 2.4M 
[SND]dj2.mp32022-08-11 15:16 5.5M 
[SND]Lyusya_CHebotina_-_SOLNCE_MONAKO_73236442.mp32022-08-11 15:16 0  
[SND]JAY DVRDEN-akatsuki.exe-kissvk.com.mp32022-08-11 15:15 0  
[SND]EDSON NUÑEZ DANIEL LÜDTKE GRACIA CLIPE OFICIAL.mp32022-08-11 15:13 0  
[SND]aarne-feat.-anikv-bushido-zho-tesno.mp32022-08-11 15:12 0  
[SND]Gazan_-_ABU_BANDIT_71958609.mp32022-08-11 15:11 0  
[SND]AFSAL3.mp32022-08-11 15:10 0  
[SND]AFSAL2.mp32022-08-11 15:09 0  
[SND]DJAKUMAU.mp32022-08-11 15:05 0  
[SND]Lil Uzi Vert - XO Tour Llif3 (Official Music Video) (mp3cut.net) (1).mp32022-08-11 15:00 0  
[SND]ข.mp32022-08-11 14:46 0  
[SND]play_back.mp32022-08-11 14:45 0  
[SND]asekGG.mp32022-08-11 14:37 0  
[SND]bale1.mp32022-08-11 14:33 0  
[SND]Cau 3.1 - Minna - Nghe.mp32022-08-11 14:33 0  
[SND]Zer.mp32022-08-11 14:30 0  
[SND]beat.mp32022-08-11 14:29 5.4M 
[SND]cj7.mp32022-08-11 14:25 0  
[SND]BBBB.mp32022-08-11 14:22 0  
[SND]likin.mp32022-08-11 14:22 0  
[SND]gedh.mp32022-08-11 14:19 0  
[SND]Aarne_BUSHIDO_ZHO_ANIKV_-_Tesno_74640918.mp32022-08-11 14:12 0  
[SND]aljona_shvec_-_Barabanshhica_73921923.mp32022-08-11 14:00 0  
[SND]DJRANX.mp32022-08-11 13:53 0  
[SND]birthday1.mp32022-08-11 13:51 0  
[SND]YOYO.mp32022-08-11 13:51 0  
[SND]indonesia.mp32022-08-11 13:50 0  
[SND]lagu.mp32022-08-11 13:49 332K 
[SND]y2mate.com - LAGU INDONESIA RAYA TEXT DAN VOCAL ORIGINAL OFFICIAL.mp32022-08-11 13:48 0  
[SND]sparks.mp32022-08-11 13:44 0  
[SND]tekit.mp32022-08-11 13:42 2.5M 
[SND]myworld.mp32022-08-11 13:40 0  
[SND]Kopikap1.mp32022-08-11 13:37 2.5M 
[SND]Hans zimmer - Interstellar No Time for Caution.mp32022-08-11 13:35 0  
[SND]crycgs.mp32022-08-11 13:34 0  
[SND]MAMA.mp32022-08-11 13:34 2.1M 
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX VIRAL TIKTOK TERBARU 2022 JEDAG JEDUG FULL BASS DJ CAMPURAN.mp32022-08-11 13:34 0  
[SND]Berkelana1.mp32022-08-11 13:32 0  
[SND]bublegum.mp32022-08-11 13:31 0  
[SND]sb.mp32022-08-11 13:30 0  
[SND]james.mp32022-08-11 13:29 508K 
[SND]pendhoza_pendhoza-ninggal-janji-new-version(2).mp32022-08-11 13:27 0  
[SND]Kopikap4.mp32022-08-11 13:27 0  
[SND]Phonk.mp32022-08-11 13:25 1.3M 
[SND]Putri Kristya Gubuk Asmoro DC Musik.mp32022-08-11 13:25 0  
[SND]Bojo2.mp32022-08-11 13:23 0  
[SND]meoww1.mp32022-08-11 13:23 0  
[SND]Https.github.mp32022-08-11 13:21 0  
[SND]Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik(6).mp32022-08-11 13:21 0  
[SND]download.mp32022-08-11 13:20 0  
[SND]Bojo1.mp32022-08-11 13:20 0  
[SND]geng04.mp32022-08-11 13:18 756K 
[SND]Everyday Normal Guy 2.mp32022-08-11 13:18 157K 
[VID]Eminem - Venom.mp42022-08-11 13:16 0  
[SND]Tiara1.mp32022-08-11 13:15 0  
[SND]Farel2.mp32022-08-11 13:15 0  
[SND]Satru2.mp32022-08-11 13:13 0  
[SND]Shade.mp32022-08-11 13:09 2.8M 
[SND][lagu1s.com]Gugur Bunga Versi Asli.xnkeuf-Jtqc.mp32022-08-11 13:08 520K 
[SND]alok.mp32022-08-11 13:08 1.5M 
[SND]Davin4.mp32022-08-11 13:07 0  
[SND]j-hope-bts-more-mp3.mp32022-08-11 13:07 0  
[SND]Davin5.mp32022-08-11 13:06 0  
[SND]Cheriimoya_Living_life_in_the_night_remix.mp32022-08-11 13:02 0  
[SND]marcocks.mp32022-08-11 13:01 0  
[SND]amaremix.mp32022-08-11 13:01 0  
[SND]Tom Odell - Another Love (Lyrics).mp32022-08-11 13:01 4.4M 
[SND]2pac-2.mp32022-08-11 12:59 0  
[SND]White_Boy_X_Nasty_Babe_-_Dura_73283215.mp32022-08-11 12:53 0  
[SND]Davin3.mp32022-08-11 12:51 0  
[SND]2pac-1.mp32022-08-11 12:51 0  
[SND]April1.mp32022-08-11 12:51 0  
[SND]Ran1.mp32022-08-11 12:50 0  
[SND]MatritzenOperation (DJ Cannabis Coffeeshops Deutschland).mp32022-08-11 12:49 0  
[SND]Guyonw1.mp32022-08-11 12:49 936K 
[SND]aa.mp32022-08-11 12:49 2.6M 
[SND]bb.mp32022-08-11 12:48 836K 
[SND]Mr_Lambo_Chicago_73869133.mp32022-08-11 12:46 0  
[SND]Duyan.mp32022-08-11 12:44 4.7M 
[SND]misha_xramovi_-_gaichite.mp32022-08-11 12:35 0  
[SND]JenJoon - Soukara _ ٰسُكارَى (Official Video).mp3.mp32022-08-11 12:32 0  
[SND]JenJoon - Soukara _ ٰسُكارَى (Official Video).mp32022-08-11 12:30 0  
[SND]djakumeriang.mp32022-08-11 12:28 0  
[SND]Rucez.mp32022-08-11 12:25 604K 
[SND]9N.mp32022-08-11 12:23 0  
[SND]1975.mp32022-08-11 12:19 0  
[SND]JJJJ.mp32022-08-11 12:18 1.8M 
[SND]Dance13.mp32022-08-11 12:11 0  
[SND]Dance12.mp32022-08-11 12:11 0  
[SND]Dance11.mp32022-08-11 12:11 0  
[SND]Dance10.mp32022-08-11 12:11 0  
[SND]Dance9.mp32022-08-11 12:10 2.6M 
[SND]Dance8.mp32022-08-11 12:10 4.1M 
[SND]Dance7.mp32022-08-11 12:10 5.6M 
[SND]Dance6.mp32022-08-11 12:10 3.0M 
[SND]Dance5.mp32022-08-11 12:10 4.5M 
[SND]Dance4.mp32022-08-11 12:10 3.8M 
[SND]Dance3.mp32022-08-11 12:10 4.2M 
[SND]Dance2.mp32022-08-11 12:10 3.2M 
[SND]Dance02.mp32022-08-11 12:09 2.3M 
[SND]VinKy15.mp32022-08-11 11:59 0  
[SND]Dimas7.mp32022-08-11 11:57 0  
[SND]Dimas1.mp32022-08-11 11:55 0  
[SND]SLK.mp32022-08-11 11:50 0  
[SND]NANE - DOUGH THO' 💰 (video oficial).mp32022-08-11 11:50 0  
[SND]meneketehe.mp32022-08-11 11:50 3.8M 
[SND]Yen1.mp32022-08-11 11:50 0  
[SND]Denn1.mp32022-08-11 11:50 0  
[SND]Denn2.mp32022-08-11 11:50 0  
[SND]Ek Tera Naam hai Sacha Lyrics _ ABCD2 _ Varun Dhavan __.mp32022-08-11 11:49 0  
[SND]Jennie.mp32022-08-11 11:46 0  
[SND]dkl00.mp32022-08-11 11:44 0  
[SND]dkl0.mp32022-08-11 11:44 952K 
[SND]Dimas.mp32022-08-11 11:40 2.9M 
[SND]DimasAnjayMabar.mp32022-08-11 11:39 0  
[SND][MV] Rapsodi - JKT48.mp32022-08-11 11:38 0  
[SND]xRiltz209.mp32022-08-11 11:37 0  
[SND]MACAN - Без названия.mp32022-08-11 11:37 0  
[SND]OGJFPGJFDPGJDOFPJG.mp32022-08-11 11:37 0  
[SND]sweet_groove.mp32022-08-11 11:33 0  
[SND]IMPERATOR.mp32022-08-11 11:32 4.9M 
[SND]7065830654449109786.mp32022-08-11 11:32 0  
[SND](FREE) Lo-fi Type Beat - I Need a Girl(MP3_160K).mp32022-08-11 11:31 0  
[SND]Dj Gue Mah Bodo Amat X Aku Hamil Duluan Mengkane Viral Tiktok 2022.mp32022-08-11 11:29 0  
[SND]Dance01.mp32022-08-11 11:27 3.0M 
[SND]xRiltz1009.mp32022-08-11 11:26 0  
[SND]xRiltz1010.mp32022-08-11 11:26 0  
[SND]xRiltz1007.mp32022-08-11 11:25 0  
[SND]xRiltz1005.mp32022-08-11 11:25 0  
[SND]xRiltz1004.mp32022-08-11 11:25 0  
[SND]xRiltz1001.mp32022-08-11 11:25 0  
[SND]xRiltz1006.mp32022-08-11 11:25 0  
[SND]xRiltz1002.mp32022-08-11 11:25 0  
[SND]xRiltz1003.mp32022-08-11 11:25 0  
[SND]xRiltz101.mp32022-08-11 11:22 0  
[SND]Mother Mother - Wisdom_(audiohunter.ru).mp32022-08-11 11:18 0  
[SND]zaur-magomadov-idet-karavan-iz-irana.mp32022-08-11 11:16 0  
[SND]Dushistyj_plan_Karavan_Ormars_remix.mp32022-08-11 11:12 3.8M 
[SND]ilulsad5.mp32022-08-11 11:08 0  
[SND]usituru.mp32022-08-11 11:07 1.4M 
[SND]Malamini.mp32022-08-11 11:07 9.0M 
[SND]y2mate.com - Mahmut Orhan Ft Sena Sener Feel Extended Drop.mp32022-08-11 11:06 0  
[SND]jamet.mp32022-08-11 11:04 0  
[SND]Shiv Jan sewa.mp32022-08-11 11:02 0  
[SND]bodievkruzak200spectatorremix.mp32022-08-11 11:00 0  
[SND]prialain.mp32022-08-11 10:59 0  
[SND]ichapi5.mp32022-08-11 10:56 0  
[SND]StandHereAlone.mp32022-08-11 10:55 0  
[SND]Strong - One Direction (speed up version).mp32022-08-11 10:54 0  
[SND]ichapi4.mp32022-08-11 10:51 0  
[SND]danger.mp32022-08-11 10:51 831K 
[SND]dandelions cover.mp32022-08-11 10:44 2.4M 
[SND]kesukaan.mp32022-08-11 10:43 0  
[SND]Black No. 1 (Little Miss Scare -All).mp32022-08-11 10:43 0  
[SND]Den1.mp32022-08-11 10:43 2.2M 
[SND]Fav1.mp32022-08-11 10:42 1.0M 
[SND]Jastin.mp32022-08-11 10:41 1.7M 
[SND]fsijfs.mp32022-08-11 10:41 0  
[SND]DUST.mp32022-08-11 10:38 0  
[SND]SDFJSDF.mp32022-08-11 10:38 0  
[SND](downloadlagu321z.net) - TRICKSTER TILL I DIED - Prod.By MANGBORIS (Official Audio) (1).mp32022-08-11 10:37 0  
[SND]remix1.mp32022-08-11 10:22 2.7M 
[SND]Jokoti(4).mp32022-08-11 10:19 0  
[SND]Jack.mp32022-08-11 10:18 0  
[SND]P9.mp32022-08-11 10:14 0  
[SND]MNUEIW.mp32022-08-11 10:14 0  
[SND]Farel Prayoga Satru 2.mp32022-08-11 10:14 0  
[SND]SAD1111.mp32022-08-11 10:12 0  
[SND]Orange.mp32022-08-11 10:12 0  
[SND]Jokoti(2).mp32022-08-11 10:12 0  
[SND]Y6mta.mp32022-08-11 10:10 0  
[SND]muli (2).mp32022-08-11 10:08 0  
[SND]Dj Fisto-B-Itz-EnRouteHouse120.mp32022-08-11 10:07 4.4M 
[SND]kg.mp32022-08-11 10:05 0  
[SND]nowbita.mp32022-08-11 10:05 0  
[SND]P1.mp32022-08-11 10:03 0  
[SND]Nobita.mp32022-08-11 10:03 0  
[SND]KayGanda.mp32022-08-11 10:03 0  
[SND]kumpas.mp32022-08-11 10:00 2.0M 
[SND]Re-Up.mp32022-08-11 09:59 0  
[SND]Moira Dela Torre - Kumpas (Official Lyric Visualizer) (1).mp32022-08-11 09:57 0  
[SND]Marko Rudio - Ikaw lang (Nobita) cover.mp32022-08-11 09:57 0  
[SND]Muli- Ace Banzuelo drum cover.mp32022-08-11 09:57 0  
[SND]enak.mp32022-08-11 09:55 3.3M 
[SND]m52.mp32022-08-11 09:55 0  
[SND]m51.mp32022-08-11 09:55 0  
[SND]Black Mirror Soundtrack Hang the Dj - Hours, Days, Months.mp32022-08-11 09:53 0  
[SND]Cash Cash-Hero.mp32022-08-11 09:53 0  
[SND]sakit.mp32022-08-11 09:52 3.5M 
[SND]Comment.mp32022-08-11 09:51 2.6M 
[SND]Cash Cash - Hero feat. Christina Perri [Official Audio].mp32022-08-11 09:46 0  
[SND]DJ Aku meriang.mp32022-08-11 09:42 2.3M 
[SND]AUD-20220811-WA0000.mp32022-08-11 09:39 0  
[SND]DJ.AKU MERIANG MERINDUKAN KASIH SAYANG CITATA VIRAL TIKTOK fyptiktok 🎧.mp32022-08-11 09:30 0  
[SND]【明白神的旨意】第2讲(上半部分).mp32022-08-11 09:28 0  
[SND]mashup.mp32022-08-11 09:24 0  
[SND]y2mate.com - Sound Yang Lagi Viral Di TikTok RizkiSz Dj Midua Cinta Mengkane Bootleg Raka Remixer.mp32022-08-11 09:24 0  
[SND]Destroy_Lonely_-_Loyalti.mp32022-08-11 09:18 0  
[SND]promqueen.mp32022-08-11 09:17 2.0M 
[SND]prom queen.mp32022-08-11 09:16 1.9M 
[SND]X2Download.mp32022-08-11 09:14 0  
[SND]Pogi9.mp32022-08-11 09:13 0  
[SND]Duo.mp32022-08-11 09:12 0  
[SND]Pogi7.mp32022-08-11 09:10 0  
[SND]Pogi8.mp32022-08-11 09:09 0  
[SND]Vamos.mp32022-08-11 09:09 0  
[SND]y2mate.com - HUYỀN TÂM MÔN LẦN HẸN HÒ ĐẦU TIÊN Prod BEGINNING OFFICIAL AUDIO.mp32022-08-11 09:04 0  
[SND]duran-ozer-siki-baba.mp32022-08-11 09:02 0  
[VID]اغنية كردية ريمكس عشقه ملايين من الأكراد سوراني (كوردمو كوردستانيم).mp42022-08-11 09:01 0  
[SND]John124.mp32022-08-11 08:56 2.0M 
[SND]0001.mp32022-08-11 08:55 0  
[SND]V.mp32022-08-11 08:53 0  
[SND]mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_256kbps.mp32022-08-11 08:52 0  
[SND]zxen3.mp32022-08-11 08:50 0  
[SND]Pogi3.mp32022-08-11 08:48 0  
[SND]Pogi2.mp32022-08-11 08:47 0  
[SND]Umb.mp32022-08-11 08:47 0  
[SND]Pogi1.mp32022-08-11 08:46 0  
[SND]Yaukoshi, LXST CXNTURY Цой - Кончится Odium.mp32022-08-11 08:46 0  
[SND]kurd1.mp32022-08-11 08:46 0  
[SND]mp3-now.com - Kannil Kannil Lyrical Video Sita Ramam Malayalam Dulquer Mrunal Vishal Hanu Raghavapudi_96kbps.mp32022-08-11 08:44 0  
[SND]AR23.mp32022-08-11 08:41 0  
[SND]gio-pika-fontanchik-s-chernym-delfinom(mp3name.co).mp32022-08-11 08:40 0  
[VID]VN20220511_184453_001.mp42022-08-11 08:38 0  
[SND]DjSleep82.mp32022-08-11 08:35 0  
[SND]KINO_-_Zakrojj_za_mnojj_dver_ya_ukhozhu_(musmore.com).mp32022-08-11 08:34 0  
[SND]Кино - Закрой за мной дверь я ухожу.mp32022-08-11 08:33 0  
[SND]AR1.mp32022-08-11 08:33 0  
[SND]E.C. 2151 - Demon's Tilt.mp32022-08-11 08:31 0  
[SND]Ezra5.mp32022-08-11 08:27 0  
[SND]djdesa81.mp32022-08-11 08:23 0  
[SND]banding.mp32022-08-11 08:21 0  
[SND]DJ TANGKIS DAANG X PAPALI BERNYANYI SOUND MAHA TREND TAHUN LAHIR VIRAL TIKTOK.mp32022-08-11 08:18 0  
[SND]Wrrp3.mp32022-08-11 08:18 0  
[SND]Keizaro2.mp32022-08-11 08:18 3.8M 
[SND]Keizaro5.mp32022-08-11 08:18 4.2M 
[SND]Keizaro4.mp32022-08-11 08:17 3.8M 
[SND]Keizaro9.mp32022-08-11 08:17 3.1M 
[SND]Keizaro11.mp32022-08-11 08:17 2.8M 
[SND]Wrrp4.mp32022-08-11 08:17 0  
[SND]Wrrp6.mp32022-08-11 08:16 0  
[SND]Powfu - Death Bed (8D Audio Lyrics) feat. Beabadoobee dont stay away for to.mp32022-08-11 08:16 0  
[SND]Wrrp1.mp32022-08-11 08:15 0  
[SND]y2meta.com - Nonstop 2022 - I Don't Know Her Name Remix - Nhạc Hot Trend Xu Hướng Tik Tok 2022 (320 kbps).mp32022-08-11 08:14 1.1M 
[SND]R.I.P.mp32022-08-11 08:14 2.8M 
[SND]Sakit Gigi.mp32022-08-11 08:13 5.5M 
[SND]letiteat.mp32022-08-11 08:12 1.3M 
[SND]pakpong.mp32022-08-11 08:11 496K 
[SND]Boom.mp32022-08-11 08:10 24K 
[SND]Cewo_-_Underworld_Remix_low_bass_by_ed4et_73431420.mp32022-08-11 08:08 0  
[SND]myoops.mp32022-08-11 08:04 3.5M 
[SND]Thotiana.mp32022-08-11 08:04 2.0M 
[SND]tr1.mp32022-08-11 07:54 15M 
[SND]SHokk_-_Mne_tebe_nechego_skazat_prosti_no_ty_ne_pojmyosh_Tot_zhar_i_zhazhda_izchezli_ostalas_syrost_(iPleer.com).mp32022-08-11 07:53 4.6M 
[SND]Kung_Ikay_Akin_-_Lyrics_by_Chocolate_Factory_[ConverteZilla.com].mp32022-08-11 07:52 3.8M 
[SND]djkane2.mp32022-08-11 07:48 37M 
[SND]fn.mp32022-08-11 07:47 5.2M 
[SND]JoJo-Allopening_(allmp3.su).mp32022-08-11 07:46 16M 
[SND]Anjay.mp32022-08-11 07:46 4.3M 
[SND]aty.mp32022-08-11 07:45 8.8M 
[SND]это.mp32022-08-11 07:43 9.3M 
[SND]djkane1.mp32022-08-11 07:42 3.9M 
[SND]sad01.mp32022-08-11 07:40 0  
[SND]это.mp3.mp32022-08-11 07:39 0  
[SND]Heartbreaking.mp3.mp32022-08-11 07:37 0  
[SND]djnioi.mp32022-08-11 07:37 0  
[SND]Teki.mp32022-08-11 07:33 0  
[SND]djkane.mp32022-08-11 07:32 212K 
[SND]frien.mp32022-08-11 07:29 0  
[SND]fonovaja_muzika_dlja_video4_-_bez_nazvanija_(z2.fm).mp32022-08-11 07:28 0  
[SND]Miyagi & Andy Panda - Патрн.mp32022-08-11 07:27 0  
[SND]bt.mp32022-08-11 07:23 764K 
[SND]KGC.mp32022-08-11 07:21 0  
[SND]orang.mp32022-08-11 07:19 0  
[SND]willrain.mp32022-08-11 07:19 0  
[SND]y2mate.com - DJ MENEKETEHE X STENDING MOTOR X BANGUN TIDUR SELFIE MENGKANE.mp32022-08-11 07:19 3.8M 
[SND]The Purge - Announcement HD.mp32022-08-11 07:15 0  
[SND]Sanaallmahal.mp32022-08-11 07:05 1.5M 
[SND]Simulashan.mp32022-08-11 07:02 2.8M 
[SND]Halakashan.mp32022-08-11 07:02 2.1M 
[SND]Kagome.mp32022-08-11 06:59 3.7M 
[SND]9naga.mp32022-08-11 06:59 906K 
[SND]Holdme.mp32022-08-11 06:59 3.3M 
[SND]JJ.mp32022-08-11 06:59 1.7M 
[SND]J.mp32022-08-11 06:58 1.2M 
[SND]Halik.mp32022-08-11 06:58 4.2M 
[SND]Guns.mp32022-08-11 06:58 5.0M 
[SND]Hero.mp32022-08-11 06:58 1.7M 
[SND]Heathens.mp32022-08-11 06:58 3.3M 
[SND]Heather.mp32022-08-11 06:58 2.7M 
[SND]Heart.mp32022-08-11 06:58 2.4M 
[SND]Dreams.mp32022-08-11 06:57 3.3M 
[SND]Easyonme.mp32022-08-11 06:57 3.4M 
[SND]end.mp32022-08-11 06:57 3.3M 
[SND]Ganonparen.mp32022-08-11 06:57 2.7M 
[SND]Datingtayo.mp32022-08-11 06:57 3.9M 
[SND]Dope.mp32022-08-11 06:56 3.2M 
[SND]Неизвестен — Зачем она берёт мужские письки в рот (www.lightaudio.ru) (1).mp32022-08-11 06:56 1.1M 
[SND]Easy.mp32022-08-11 06:56 127K 
[SND]Again.mp32022-08-11 06:56 3.1M 
[SND]Broken.mp32022-08-11 06:56 2.4M 
[SND]keduoitheoanhsang.mp32022-08-11 06:56 0  
[SND]Bed.mp32022-08-11 06:55 2.7M 
[SND]ACDMND.mp32022-08-11 06:55 4.6M 
[SND]blue.mp32022-08-11 06:55 2.3M 
[SND]balls.mp32022-08-11 06:55 2.7M 
[SND]Atlantic.mp32022-08-11 06:55 2.7M 
[SND]zone.mp32022-08-11 06:54 0  
[SND]Dj3.mp32022-08-11 06:51 1.8M 
[SND]naga.mp32022-08-11 06:51 0  
[SND]mikee2.mp32022-08-11 06:47 0  
[SND]02.Mon_Bojhe_Na-Arijit_Singh_FusionBD.Com.mp32022-08-11 06:43 0  
[SND]Relax.mp32022-08-11 06:42 580K 
[SND]ms.mp32022-08-11 06:40 3.3M 
[SND]y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D.mp32022-08-11 06:26 0  
[SND]gonefludd_-_kubik_lda_(zf.fm).mp32022-08-11 06:19 0  
[SND]ecec2.mp32022-08-11 06:19 0  
[SND]Marko1.mp32022-08-11 06:17 0  
[SND]0608_525f_0159_1b9ea4ee07e5c709f0f2633181f994e0.mp32022-08-11 06:16 0  
[SND]_Mohabbat_Barsa_De__Full_Video_Song_Ft._Arjun___Creature_3D,_Surveen_Chawla_.mp32022-08-11 06:14 0  
[SND]y2mate.com - Kẻ Theo Đuổi Ánh Sáng Lofi Ver Huy Vạc x Tiến Nguyễn x Freak D_320kbps.mp32022-08-11 06:13 0  
[SND]02.Honved Ensemble - 02 A Nyugati Gregorian Es A Magyar Nepdal Talalkozasa.mp32022-08-11 06:11 0  
[SND]james19.mp32022-08-11 06:10 0  
[SND]james20.mp32022-08-11 06:10 0  
[SND]HAR10.mp32022-08-11 06:09 0  
[SND]HAR13.mp32022-08-11 06:09 4.4M 
[SND]Kobo7.mp32022-08-11 06:09 943K 
[SND]HAR4.mp32022-08-11 06:09 0  
[SND]HAR5.mp32022-08-11 06:09 0  
[SND]HAR6.mp32022-08-11 06:08 0  
[SND]HAR7.mp32022-08-11 06:08 0  
[SND]HAR8.mp32022-08-11 06:08 0  
[SND]HAR9.mp32022-08-11 06:08 0  
[SND]lil_bank_-_LVL_drift_fonk_Bassbust_(TheMP3.Info).mp32022-08-11 06:07 0  
[SND]Har14.mp32022-08-11 06:07 0  
[SND]Har13.mp32022-08-11 06:07 0  
[SND]Har12.mp32022-08-11 06:06 0  
[SND]AniSh-MaHli-New-Nagpuri-Bewafa-Song-2022-Dj-Nagpuri-Song-2022-Dj-Pawan-Bedia_2q5yhjZC7uI.mp32022-08-11 06:04 0  
[SND]Yh.mp32022-08-11 06:02 3.9M 
[SND]Tandi1.mp32022-08-11 06:02 0  
[SND]C5162.mp32022-08-11 06:01 0  
[SND]Close55.mp32022-08-11 06:00 0  
[SND]s7.mp32022-08-11 05:54 0  
[SND]ayaayi.mp32022-08-11 05:53 0  
[SND]you_win_1.mp32022-08-11 05:52 0  
[SND]misel.mp32022-08-11 05:48 388K 
[SND]DJ Meneketehe VinKy ft. Abub YETE.mp32022-08-11 05:45 3.8M 
[SND]Cosmo Sheldrake - Nightjar Wake up Call.mp32022-08-11 05:41 0  
[SND]Sadrrt.mp32022-08-11 05:40 0  
[SND]theweeknd.mp32022-08-11 05:40 0  
[SND]VinKy10.mp32022-08-11 05:39 3.1M 
[SND]Shower again.m4a2022-08-11 05:37 142K 
[SND]Iwas1.mp32022-08-11 05:36 0  
[SND]245.mp32022-08-11 05:34 0  
[SND]hoh.mp32022-08-11 05:34 0  
[SND]hohh.mp32022-08-11 05:34 2.1M 
[SND]Iwas.mp32022-08-11 05:33 0  
[SND]Wednesdaysex.m4a2022-08-11 05:33 280K 
[SND]SIARAN ONLINE Mixdown 1.mp32022-08-11 05:27 0  
[SND]ketche.mp32022-08-11 05:26 0  
[SND]mybrother.mp32022-08-11 05:26 0  
[SND]FileMorphOutput.mp32022-08-11 05:22 0  
[SND]4_6010582219926544407.mp32022-08-11 05:08 0  
[SND]4_6014999348977342305.mp32022-08-11 05:07 0  
[SND]Alvino.mp32022-08-11 05:07 0  
[SND]Фая.mp32022-08-11 05:07 0  
[SND][lagu1s.com]DJ KU HAMIL DULUAN REMIX __ VIRAL TIKTOK.itL8liAGKro.mp32022-08-11 05:05 0  
[SND]rzali.mp32022-08-11 05:03 0  
[SND]zz.mp32022-08-11 05:02 2.4M 
[SND]Y2Mate.is - Japanese Guy Yelling-UpjYTwNjWc8-160k-1660193861394-[AudioTrimmer.com].mp32022-08-11 05:01 0  
[SND]elsakane5.mp32022-08-11 04:59 0  
[SND]HARAM.mp32022-08-11 04:54 1.9M 
[SND]Kobo8.mp32022-08-11 04:48 2.7M 
[SND]Kobo4.mp32022-08-11 04:45 0  
[SND]yy.mp32022-08-11 04:39 3.4M 
[SND]ERIKA1.mp32022-08-11 04:38 0  
[SND]xy.mp32022-08-11 04:37 0  
[SND]xx.mp32022-08-11 04:33 3.3M 
[SND]SEYNONSTOP.mp32022-08-11 04:33 0  
[SND]tw.mp32022-08-11 04:31 0  
[SND]Week 2 Support.mp32022-08-11 04:28 0  
[SND]Week 3 Support.mp32022-08-11 04:28 0  
[SND]Week 4 Support.mp32022-08-11 04:27 1.7M 
[SND]Week 1 Support.mp32022-08-11 04:26 0  
[SND]mgc.mp32022-08-11 04:25 0  
[SND]Sey2.mp32022-08-11 04:25 0  
[SND]Bimbo.mp32022-08-11 04:23 0  
[SND]Rain.mp32022-08-11 04:22 924K 
[SND]KANECOK.mp32022-08-11 04:20 0  
[SND]industry.mp32022-08-11 04:15 0  
[SND]specret.mp32022-08-11 04:14 0  
[SND]Daa.mp32022-08-11 04:11 3.3M 
[SND]KG _ Nik Makino ( Lyrics ).mp32022-08-11 04:11 0  
[SND]y2mate.com - Lil Nas X HOLIDAY Official Video.mp32022-08-11 04:08 0  
[SND]CORRUPTION - 101 OST.mp32022-08-11 04:07 0  
[SND]Високосный Год - Тихий Огонек.mp32022-08-11 04:03 0  
[SND]djviral.mp32022-08-11 04:03 3.8M 
[SND]СИНИЕ ФИАЛКИ - The Limba (1).m4a2022-08-11 04:02 0  
[SND]Sey1.mp32022-08-11 04:02 0  
[SND]Sey5.mp32022-08-11 03:59 0  
[SND]Sey4.mp32022-08-11 03:58 0  
[SND]Sey3.mp32022-08-11 03:58 0  
[SND]walk with me1.mp32022-08-11 03:55 272K 
[SND]Super boom 2019 Dj Ciray Nonstop bass cực phiêu.mp32022-08-11 03:50 0  
[SND]MIGUELA.mp32022-08-11 03:50 0  
[SND]Hbpasyon123.mp32022-08-11 03:46 0  
[SND]happy birthday remix 2021 _ happy birthday to you _ happy birthday techno budots 2021.mp32022-08-11 03:45 0  
[SND]audio.mp32022-08-11 03:42 544K 
[SND]y2mate.com - Lỡ Yêu Người Đậm Sâu Lofi Ver Linh Hương Luz Cánh Hoa tàn tình tan và em bay theo gió ngàn_320kbps.mp32022-08-11 03:42 1.4M 
[SND]funkot.mp32022-08-11 03:40 1.5M 
[SND]BILAL1.mp32022-08-11 03:38 2.9M 
[SND]Kira1123.mp32022-08-11 03:38 0  
[SND]Proyecto TQ - Fuego (OST Сыны анархии 5 сезон).mp32022-08-11 03:36 0  
[SND]y2mate.com - Tương Tư Nan Tuyệt Remix Đại Thần Tuệ Top 10 Bài hát TikTok MỚI NHẤT tuần vừa qua AML MUSIC.mp32022-08-11 03:33 0  
[SND]hbpasyon.mp32022-08-11 03:33 0  
[SND]dj6.mp32022-08-11 03:31 436K 
[SND]HBkira1.mp32022-08-11 03:31 0  
[SND]y2mate.com - Lãng Tử Nhàn Thoại Thiên Tú HM Remix Thái Quỳnh Cover Hot Tiktok 2020.mp32022-08-11 03:24 3.9M 
[SND]Virgoun - Surat Cinta Untuk Starla (Official Lyric Video).mp32022-08-11 03:24 4.2M 
[SND]y2mate.com - Perfect Ed Sheeran Lyrics.mp32022-08-11 03:21 0  
[SND]TIIL I DIE1.mp32022-08-11 03:19 0  
[SND]sanji01.mp32022-08-11 03:13 0  
[SND]djkedua.mp32022-08-11 03:11 0  
[SND]kurdhell.mp32022-08-11 03:11 0  
[SND]kedua.mp32022-08-11 03:11 0  
[SND]egk.mp32022-08-11 03:09 0  
[SND]sunami1.mp32022-08-11 03:09 0  
[SND]ygkedua.mp32022-08-11 03:05 0  
[SND](01) [Ray Manzarek] Too Close To The Sun.mp32022-08-11 03:03 0  
[SND]jadikan.mp32022-08-11 03:01 0  
[SND]mcrp.mp32022-08-11 02:53 0  
[SND]Qwerty.mp32022-08-11 02:50 0  
[SND]Smp1.mp32022-08-11 02:47 0  
[SND]345345.mp32022-08-11 02:38 0  
[SND]123123.mp32022-08-11 02:36 0  
[SND]Smile.mp32022-08-11 02:22 0  
[SND]Come.mp32022-08-11 02:17 4.1M 
[SND]Buhay.mp32022-08-11 02:17 0  
[SND]Myself.mp32022-08-11 02:14 0  
[SND]Lorna Shore - To the Hellfire.mp32022-08-11 02:13 444K 
[SND]mrp.mp32022-08-11 02:13 227K 
[SND]jaya.mp32022-08-11 02:10 1.1M 
[SND]05 Montreux Inventions.mp32022-08-11 02:09 1.5M 
[SND](MV) JJJJ - Bung Saranghae (Prod.by บังจะบิน ).mp3.mp32022-08-11 02:06 0  
[SND]MURDER.mp32022-08-11 01:59 0  
[SND]Har22.mp32022-08-11 01:57 0  
[SND]Har21.mp32022-08-11 01:57 0  
[SND]DODI.mp32022-08-11 01:53 0  
[SND]Makeawishnct.mp32022-08-11 01:47 0  
[SND]Make a wish nct.mp32022-08-11 01:44 0  
[SND]Marko7.mp32022-08-11 01:42 0  
[SND]Marko5.mp32022-08-11 01:42 0  
[SND]Marko3.mp32022-08-11 01:42 0  
[SND]Marko2.mp32022-08-11 01:42 0  
[SND]Marko4.mp32022-08-11 01:42 0  
[SND]Dangdut1.mp32022-08-11 01:40 0  
[SND]KNTL.mp32022-08-11 01:39 1.3M 
[SND]JOKOTINGKIR.mp32022-08-11 01:37 0  
[SND]The Weeknd - Is There Someone Else (Official Audio).mp32022-08-11 01:33 0  
[SND]Die For You.mp32022-08-11 01:33 4.0M 
[SND]YUMMY_7 (2).mp32022-08-11 01:27 0  
[SND]djogi.mp32022-08-11 01:26 0  
[SND]power.mp32022-08-11 01:26 0  
[SND]NCTUMake_A_Wish_Birthday_Song_MV_tyrVtwE8Gv0_140.mp3s.mp32022-08-11 01:26 0  
[SND]morning-with-coffee-loop_GytAO4Eu.mp32022-08-11 01:20 0  
[SND]WhatsApp Audio 2022-08-11 at 08.13.48.mp3s.mp32022-08-11 01:16 340K 
[SND]lian.mp32022-08-11 01:04 0  
[SND]ADLIN_-_Dead_Inside_73224409.mp32022-08-11 00:59 0  
[SND]Lagi1.mp32022-08-11 00:56 0  
[SND]yt1s.com - Hari ini hari ulang tahunmu Mentahan LirikAesthetic .mp32022-08-11 00:55 0  
[SND]momong.mp32022-08-11 00:50 0  
[SND]pizzapastaputitinabox.mp32022-08-11 00:47 0  
[SND]8sec.mp32022-08-11 00:38 0  
[SND]ACDC_-_Back_In_Black_47830042.mp32022-08-11 00:38 892K 
[SND]🎧🎶DJ GOLDEN CROWN BREAKBEAT VIRAL TIKTOK YANG DI CARI!!🎶🎧.mp32022-08-11 00:33 0  
[SND]dj eyes.mp32022-08-11 00:33 0  
[SND]Day89.mp32022-08-11 00:32 0  
[SND]macarena2.mp32022-08-11 00:31 0  
[SND]DJ BASS BETON OLEJON OLEJON X OCOPAKELE PARTY KELUD ALL TALENT NEW REMIX.mp32022-08-11 00:31 0  
[SND]Dj karena kamu dj tiktok terbaru 2021 karena kamu.mp32022-08-11 00:31 0  
[SND]duyz.mp32022-08-11 00:30 0  
[SND]Words30.mp32022-08-11 00:28 0  
[SND]samuel_oayk.mp32022-08-11 00:26 0  
[SND]no.mp32022-08-11 00:21 256K 
[SND]Yeni proje.mp32022-08-11 00:21 0  
[SND]after dark — mr.kitty (lyrics).mp32022-08-11 00:14 0  
[SND]DJ PAPA LIAT AKU BERNYANYI X PAPEPAP REMIX FULLBASS TERBARU.mp32022-08-11 00:14 0  
[SND]Twenty_One_Pilots_x_Stranger_Things_(getmp3.pro).mp32022-08-11 00:14 0  
[SND]Hoy.mp32022-08-11 00:08 0  
[VID]PA.mp42022-08-11 00:06 0  
[SND]LAGU.mp32022-08-10 23:54 0  
[SND]WhatsApp-Ptt-2022-08-10-at-20.38.00.mp32022-08-10 23:44 0  
[SND]Ds39.mp32022-08-10 23:44 0  
[SND]Jokoti.mp32022-08-10 23:30 0  
[SND]Denny Caknan Happy Asmara Yeni Inka Bojo Loro DC Musik.mp32022-08-10 23:27 0  
[SND]nonton.mp32022-08-10 23:27 0  
[SND]DENNY CAKNAN X HAPPY ASMARA - SATRU 2 ( Offical Li.mp32022-08-10 23:26 0  
[SND]yt1s.com - حلمي تحطم واختفى اغنية مؤثرة وجميلة AMV Ahlam song IZZ ft Emy Hetari لا تفوتك.mp32022-08-10 23:13 0  
[SND]ЛИТВИНЕНКО - Чёрные птицы.mp32022-08-10 22:58 0  
[SND]nokomen.mp32022-08-10 22:57 0  
[SND]Arturo Mejia Virtual Pros audio.mp32022-08-10 22:55 0  
[SND]dj takkan.mp32022-08-10 22:43 0  
[SND]easy11.mp32022-08-10 22:40 0  
[SND]djsm-robbe-frank-moody 3sec.mp32022-08-10 22:35 0  
[SND]- Sēnes (320kbps) (mp3cut.net).mp32022-08-10 22:29 0  
[SND]Neil Cicierega - Bega Interlude (2).mp32022-08-10 22:27 0  
[SND]Glooco.mp32022-08-10 22:24 3.9M 
[SND]Glouco.mp32022-08-10 22:23 0  
[SND]Neil Cicierega - Bega Interlude.mp32022-08-10 22:17 0  
[SND]X-WAYNE, SH3TLVIZ - RAMPAGE.mp32022-08-10 22:17 0  
[SND]GnL2.mp32022-08-10 22:14 0  
[SND]GnL1.mp32022-08-10 22:13 0  
[SND]memetj.mp32022-08-10 22:12 0  
[SND]Arabic Nokia Type Beat.mp32022-08-10 22:11 0  
[SND]ROXIE1.mp32022-08-10 22:10 0  
[SND]DEAD_BLONDE_-_Malchik_Na_Devyatke_70892133.mp32022-08-10 22:09 0  
[SND]Miyagi& Эндшпильfeat.Ре.mp32022-08-10 22:07 0  
[SND]SEDIH2.mp32022-08-10 22:06 0  
[SND]Sad5.mp32022-08-10 22:06 0  
[SND]Chepz.mp32022-08-10 22:04 0  
[SND]SAD6.mp32022-08-10 22:02 0  
[SND]ssstik.io_1660161295319 (2).mp32022-08-10 22:00 0  
[SND]ssstik.io_1660161295319.mp32022-08-10 21:59 0  
[SND]Sedih6.mp32022-08-10 21:59 0  
[SND]Delusi.mp32022-08-10 21:56 0  
[SND]DEAD BLONDE - Мальчик на девятке.mp32022-08-10 21:39 8.2M 
[SND]ojoban.mp32022-08-10 21:34 0  
[SND]szum.mp32022-08-10 21:30 0  
[SND]Wenaro, Lxner - Лёд.mp32022-08-10 21:30 0  
[SND]den_vau_tong_hop_nhung_bai_hat_hay_nhat_cua_den_vau_2022_2212807356951642854 (1).mp32022-08-10 21:08 0  
[SND]bato bre.mp32022-08-10 20:55 1.2M 
[SND]ss.mp32022-08-10 20:48 66K 
[SND]oh-no-113125.mp32022-08-10 20:48 66K 
[SND]me-hurt-sounds-40085.mp32022-08-10 20:46 401K 
[SND]Drill1.mp32022-08-10 20:46 2.2M 
[SND]Underworld (Slowed + Bass Boosted)@KNRD Music Support Our Second Channel🙏🏻.mp32022-08-10 20:44 5.6M 
[SND]Песня - По блоку катит Phantom мы как всегда на стиле.mp32022-08-10 20:39 5.7M 
[SND]VIP3.mp32022-08-10 20:37 46M 
[SND]VIP2.mp32022-08-10 20:37 25M 
[SND]VIP1.mp32022-08-10 20:36 29M 
[SND]suara pintu.mp32022-08-10 20:35 0  
[SND]Disguise.mp32022-08-10 20:35 0  
[SND]Azer.mp32022-08-10 20:28 0  
[SND]11.mp32022-08-10 20:23 0  
[SND]srra16.mp32022-08-10 20:22 0  
[SND]thechille.mp32022-08-10 20:22 372K 
[SND]december7.mp32022-08-10 20:17 0  
[SND]y2mate.com - Fell Under a Spell Remix.mp32022-08-10 20:17 0  
[SND]Dhikaa9.mp32022-08-10 20:15 0  
[SND]_DIL_KI_DOYA_HOY_NA__by_Oyshee.mp32022-08-10 20:04 0  
[SND]yerle-yeksan-drill-remix.mp32022-08-10 20:01 0  
[SND]Axepep7.mp32022-08-10 19:57 0  
[SND]jor1.mp32022-08-10 19:55 0  
[SND]memek1.mp32022-08-10 19:54 0  
[SND]Blood Upon the Risers -Gory Gory What a Hell of a Way to Die-.mp32022-08-10 19:52 0  
[SND]xcho_ty-i-ya.mp32022-08-10 19:50 0  
[SND]TAWA.mp32022-08-10 19:50 0  
[SND]pure-n-a-cnv-sound-vol-14-file.mp32022-08-10 19:48 0  
[SND]❄🍷Andreyka rmx🍷❄-🚫хуй с ним🚫-kissvk.com.mp32022-08-10 19:45 796K 
[SND]on the floor.mp32022-08-10 19:45 0  
[SND]AjiMat65.mp32022-08-10 19:45 0  
[SND]y2mate.com - MONSTER MASH.mp32022-08-10 19:41 0  
[SND]gromkaya_sirena_na_zvonok_telefona.mp32022-08-10 19:40 0  
[SND]Tabii.mp32022-08-10 19:38 0  
[SND]BalainDo5.mp32022-08-10 19:33 0  
[SND]B5.mp32022-08-10 19:27 3.6M 
[SND]vasco20.mp32022-08-10 19:25 0  
[SND]hatiku.mp32022-08-10 19:23 0  
[SND]Lucy2.mp32022-08-10 19:22 0  
[SND]Sgt3.MP.mp32022-08-10 19:22 0  
[SND]vektor-a-lyudi-mp3.mp32022-08-10 19:22 0  
[SND]Good1.mp32022-08-10 19:22 0  
[SND]PETRUNSKO_BY_FAN_ONE_BASS_BOOSTE_(getmp3.pro).mp32022-08-10 19:19 0  
[SND]Lil_Morty_-_FLEXING_FINESSING.mp32022-08-10 19:15 0  
[SND]Вектор А-Люди-kissvk.com.mp32022-08-10 19:13 0  
[SND]Get Get Down (Bass + Pitched down).mp32022-08-10 19:03 0  
[SND]the new sweet groove.mp32022-08-10 19:01 0  
[SND]ozzy.mp32022-08-10 18:57 0  
[SND]John15.mp32022-08-10 18:57 0  
[SND]1542027632_miyagi_-_rodnaya_poi_feat__kadi_muzonov_net.mp32022-08-10 18:57 0  
[SND]XXXTENTACION - Revenge (slowed & reverb)_.mp32022-08-10 18:56 0  
[SND]faceit sound.mp32022-08-10 18:52 0  
[SND]Nba YoungBoy - Chopper City.mp32022-08-10 18:51 0  
[SND]NBA YoungBoy -No Switch (music video).mp32022-08-10 18:51 0  
[SND]rb.mp32022-08-10 18:50 0  
[SND]John125.mp32022-08-10 18:50 0  
[SND]quiizzzmeow_-_Aomine_Daiki_(musmore.com).mp32022-08-10 18:47 0  
[SND][lagu1s.com]Angel Baby - Troye Sivan.aZX2BoxbUdk.mp32022-08-10 18:45 2.0M 
[SND]hhh.mp32022-08-10 18:43 0  
[SND]req.mp32022-08-10 18:41 0  
[SND]yanto02.mp32022-08-10 18:40 0  
[SND]yanto01.mp32022-08-10 18:39 0  
[SND]ধুলাবালি,_Dhulabali_by_Ashes_lyrics._Unofficial_video_song.mp32022-08-10 18:34 0  
[SND]Troye-Sivan-Angel-Baby-Lyrics_UsBOJRIAwZo.mp32022-08-10 18:33 192K 
[SND]jen.mp32022-08-10 18:22 0  
[SND]TO KILL A GOD Epic Battle Dark Heroic Music Epic Music Mix by @Audiomachine.mp32022-08-10 18:16 0  
[SND]YNV.mp32022-08-10 18:11 0  
[SND]Мельница - Бес Джиги.mp32022-08-10 18:11 2.3M 
[SND]zatyanu.mp32022-08-10 18:09 0  
[SND]22.mp32022-08-10 18:06 1.0M 
[SND]joby3.mp32022-08-10 18:04 0  
[SND]joby1.mp32022-08-10 18:04 156K 
[SND]joby2.mp32022-08-10 18:04 0  
[SND]verbee-odin-mp3-1.mp32022-08-10 17:56 0  
[SND]beograd-official-video.mp32022-08-10 17:55 0  
[SND]Masked Wolf - Pandemonium (Official Video).mp32022-08-10 17:54 0  
[SND]videoplayback.mp32022-08-10 17:54 2.4M 
[SND]BoyWithUke - Toxic.mp32022-08-10 17:53 0  
[SND]Zatyany.mp32022-08-10 17:53 0  
[SND]asitwas .mp32022-08-10 17:53 2.5M 
[SND]Waterflame - Swirl! (Chip-tune Remix).mp32022-08-10 17:53 0  
[SND]Travis_Scott_-_SICKO_MODE_ft._Drake(256k).mp32022-08-10 17:52 0  
[SND]♚💔🎲LADA PRIORA 2007🎲💔♚ - Затяну шнурки потуже подойди же что ты ну же.mp32022-08-10 17:52 0  
[SND]ck02.mp32022-08-10 17:50 0  
[SND]Rhove - Shakerando (prod. Voluptyk) (TestoLyrics) (mp3cut.net).mp32022-08-10 17:49 0  
[SND]Shadowraze - showdown.mp32022-08-10 17:44 0  
[SND]УННВ - Без даты (Remix) (Remix).mp32022-08-10 17:44 36K 
[SND]Shadowraze - shadowfiend.mp32022-08-10 17:44 5.5M 
[SND]Shadowraze - astral step.mp32022-08-10 17:44 4.6M 
[SND]ba9a.mp32022-08-10 17:44 0  
[SND]Christina_Perri_-_A_Thousand_Years_[Official_Music_Video](256k).mp32022-08-10 17:43 0  
[SND]dgsdg.mp32022-08-10 17:42 0  
[SND]6feet.mp32022-08-10 17:39 0  
[SND]atldance.mp32022-08-10 17:39 0  
[SND]scarlxrd6feet.mp32022-08-10 17:38 0  
[SND]Fly Me to the Moon (Acoustic).mp32022-08-10 17:38 0  
[SND]rider11.mp32022-08-10 17:36 0  
[SND]Ba9a Ft Gharmoul - Mkarez (official music video)[Mpgun.com].mp32022-08-10 17:35 0  
[SND]c.mp32022-08-10 17:34 136K 
[SND]H8.HOOD - PHANTOM.mp32022-08-10 17:32 0  
[SND]Oxtan2.mp32022-08-10 17:30 0  
[SND]sad1.mp32022-08-10 17:26 3.1M 
[SND]YAd_Dobra_-_Vremya_molodjozhi_68701792.mp32022-08-10 17:25 0  
[SND]sad2.mp32022-08-10 17:25 1.8M 
[SND]m.mp32022-08-10 17:22 2.8M 
[SND]pink1.mp32022-08-10 17:21 0  
[SND]Султан Лагучев - Любовь беда (Miro's Remix).mp32022-08-10 17:19 0  
[SND]ck12.mp32022-08-10 17:18 0  
[SND]iwgd.mp3.mp32022-08-10 17:17 0  
[SND]Hell March (Remastered).mp32022-08-10 17:16 0  
[SND]sad Dx.mp32022-08-10 17:15 0  
[SND]abin.mp32022-08-10 17:15 0  
[SND]Oxtan1.mp32022-08-10 17:13 0  
[SND]y2mate.com - Arctic Monkeys Snap Out Of It Official Audio.mp32022-08-10 17:08 0  
[SND]ckrider1.mp32022-08-10 17:07 0  
[SND]s1.mp32022-08-10 17:07 340K 
[SND]Gospozha_Kaguya_v_lyubvi_kak_na_vojne_-_2_sezon_Opening_(iPleer.com).mp32022-08-10 17:04 3.4M 
[SND]BlueWednesday.mp32022-08-10 17:02 2.7M 
[SND]Maprider1.mp32022-08-10 16:56 0  
[SND]m.m4a2022-08-10 16:49 0  
[SND]maprideralle.mp32022-08-10 16:47 0  
[SND]munni.mp32022-08-10 16:47 0  
[SND]maprider.mp32022-08-10 16:46 0  
[SND]perang.mp32022-08-10 16:46 1.2M 
[SND]ms13.mp32022-08-10 16:46 2.0M 
[SND]king.mp32022-08-10 16:46 3.0M 
[SND]Wala.mp3.mp32022-08-10 16:45 0  
[SND]trim.09E25743-B1D4-4D53-ABE4-5B8CA3057D2E.mp32022-08-10 16:43 0  
[SND]Wala.mp32022-08-10 16:43 0  
[SND]zill100.mp32022-08-10 16:42 0  
[SND]chinwa probleme...عطوني..شيشة.. نطلع(MP3_320K).mp32022-08-10 16:37 3.4M 
[SND]ck09.mp32022-08-10 16:32 11M 
[VID]Night.mp42022-08-10 16:32 12M 
[SND]Maskoff.mp32022-08-10 16:29 1.7M 
[SND]Chiddy-Bang-Old-Ways.mp32022-08-10 16:28 0  
[SND]Hang.mp32022-08-10 16:25 0  
[SND]vaar.mp32022-08-10 16:16 0  
[SND]Sancey.mp32022-08-10 16:15 0  
[SND]zacky4.mp32022-08-10 16:08 0  
[SND]purge.mp32022-08-10 16:02 0  
[SND]pp.mp32022-08-10 16:02 3.2M 
[SND]S7.mp32022-08-10 15:56 2.4M 
[SND]MALA - MORO FT PROFIT ZA3IM - STOOR - WEST ( VIDEO ANIMATION )(MP3_320K).mp32022-08-10 15:48 0  
[SND]MT.mp32022-08-10 15:28 0  
[SND]Swagging13.mp32022-08-10 15:25 0  
[SND]Adfi.mp32022-08-10 15:23 0  
[SND]Misaki.mp32022-08-10 15:22 2.1M 
[SND]Best.mp32022-08-10 15:20 0  
[SND]tnh.mp32022-08-10 15:19 0  
[SND]kyh.mp32022-08-10 15:19 0  
[SND]dibui.mp32022-08-10 15:18 0  
[SND]xipo.mp32022-08-10 15:18 0  
[SND]Thank you-ify jones.mp32022-08-10 15:15 0  
[SND]SADOP.mp32022-08-10 15:15 1.4M 
[SND]siren.mp32022-08-10 15:15 6.9K 
[SND]Charlie Pryce - Summer Sounds Vol 3.mp32022-08-10 15:11 0  
[SND]Minesr.mp32022-08-10 15:10 0  
[SND]Ace Banzuelo - Muli (Lyrics).mp32022-08-10 15:09 4.4M 
[SND]Bitch.mp32022-08-10 15:02 0  
[SND]BooM1.mp32022-08-10 14:56 348K 
[SND]bgmusic.mp32022-08-10 14:56 1.7M 
[SND]vikramgirl.mp32022-08-10 14:53 0  
[SND]DJSAD.mp32022-08-10 14:50 536K 
[SND]Vp13.mp32022-08-10 14:49 2.3M 
[SND]top.mp32022-08-10 14:48 3.1M 
[SND]arcade.mp32022-08-10 14:47 3.9M 
[SND]Maki.mp32022-08-10 14:25 3.5M 
[SND]sateboy.mp32022-08-10 14:09 0  
[SND]Кореш - глаза не врут.mp32022-08-10 14:08 0  
[SND]Eminem & 2Pac - Björn Ironside VS Ivar The Boneless (2019).mp32022-08-10 14:07 0  
[SND]y2mate.com - no copyright music Purple lofi background music_256kbps.mp32022-08-10 14:05 0  
[SND]mmm.mp32022-08-10 14:04 2.2M 
[SND]Thai3.mp32022-08-10 14:04 0  
[SND]Anees.mp32022-08-10 14:04 2.4M 
[SND]Ayana2.mp32022-08-10 14:02 0  
[SND]Le rêve - Chococlub.mp32022-08-10 14:02 0  
[SND]Nm1.mp32022-08-10 14:02 2.6M 
[SND]Hajib - Ezzin ( Medi Remix )(MP3_70K).mp32022-08-10 14:00 0  
[SND]orgenlampung.mp32022-08-10 13:59 0  
[SND]HatdogManila.mp32022-08-10 13:59 0  
[SND]wow.mp32022-08-10 13:55 2.1M 
[SND]Vp21.mp32022-08-10 13:54 1.2M 
[SND]Vp20.mp32022-08-10 13:54 2.5M 
[SND]Vp19.mp32022-08-10 13:54 0  
[SND]Sateboy.mp32022-08-10 13:54 1.3M 
[SND]Morshu_beatbox_loop_(getmp3.pro).mp32022-08-10 13:53 0  
[SND]nhachay.mp32022-08-10 13:51 0  
[SND]relod.mp32022-08-10 13:49 256K 
[SND]makna puasa.mp32022-08-10 13:49 0  
[SND]Bongga.mp32022-08-10 13:49 0  
[SND]RandaHalal.mp32022-08-10 13:45 0  
[SND]Lagukuu.mp32022-08-10 13:45 0  
[SND][YT2mp3.info] - Unconditionally X Dandelions (Lyrics) Slowed Version (320kbps).mp32022-08-10 13:42 0  
[SND]Dancingqueen.mp32022-08-10 13:41 0  
[SND]Jamik_-_samoljotkarmv_rmx_(musportal.org).mp32022-08-10 13:39 0  
[SND]På Topp Final.mp32022-08-10 13:39 0  
[SND]Dacingqueen.mp32022-08-10 13:37 0  
[SND]VinKy11.mp32022-08-10 13:34 3.0M 
[SND]RE.mp32022-08-10 13:31 2.9M 
[SND]HD.mp32022-08-10 13:28 0  
[SND]awitin.mp32022-08-10 13:28 696K 
[SND]AUD-20220605-WA0030.mp32022-08-10 13:26 617K 
[SND]mp11.mp32022-08-10 13:26 3.3M 
[SND]AUD-20220406-WA0026.mp32022-08-10 13:25 112K 
[SND]lk.mp32022-08-10 13:24 199K 
[SND]ASl.mp32022-08-10 13:24 0  
[SND]kl.mp32022-08-10 13:23 0  
[SND]huy1234.mp32022-08-10 13:21 0  
[SND]jh.mp32022-08-10 13:20 0  
[SND]Абрикоса - Влюбилась В Друга.mp32022-08-10 13:19 0  
[SND]หูไม่ตรงกับตา (2).mp32022-08-10 13:16 0  
[SND]DrawinCopyRight.mp32022-08-10 13:16 0  
[SND]HJ.mp32022-08-10 13:15 3.4M 
[SND]va7.mp32022-08-10 13:11 0  
[SND]hg3.mp32022-08-10 13:10 0  
[SND]AT40 01-23-1982 #1.mp32022-08-10 13:06 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK_2.mp32022-08-10 13:03 0  
[SND]Heart of Courage.mp32022-08-10 12:58 2.7M 
[SND]freelofi.mp32022-08-10 12:54 0  
[SND]Joji - Glimpse Of Us.mp32022-08-10 12:53 0  
[SND]yan29.mp32022-08-10 12:53 0  
[SND]yan25.mp32022-08-10 12:53 0  
[SND]yan24.mp32022-08-10 12:53 0  
[SND]yan23.mp32022-08-10 12:53 0  
[SND]yan28.mp32022-08-10 12:53 0  
[SND]y2mate.com - DJ HANING SING PUSING MUKA KAYA KINGKONG.mp32022-08-10 12:53 0  
[SND]yan27.mp32022-08-10 12:52 0  
[SND]yan26.mp32022-08-10 12:52 0  
[SND]janji1.mp32022-08-10 12:49 632K 
[SND]Fellixs3.mp32022-08-10 12:49 0  
[SND]Fellixs2.mp32022-08-10 12:48 0  
[SND]A7.mp32022-08-10 12:47 0  
[SND]Untitled.mp32022-08-10 12:47 0  
[SND]Fellixs1.mp32022-08-10 12:47 0  
[SND]seto1.mp32022-08-10 12:43 0  
[SND]Diviners.mp32022-08-10 12:40 0  
[SND]A6.mp32022-08-10 12:36 2.8M 
[SND]Vp18.mp32022-08-10 12:35 0  
[SND]Vp17.mp32022-08-10 12:35 1.6M 
[SND]Vp16.mp32022-08-10 12:35 3.0M 
[SND]Vp15.mp32022-08-10 12:35 3.8M 
[SND]Vp14.mp32022-08-10 12:35 3.2M 
[SND]kzsquat.mp32022-08-10 12:35 0  
[SND]y2mate.com - DJ DOMINO MAROKO TANGKIS DANG TIIKTOK VIRAL 2022.mp32022-08-10 12:34 0  
[SND]FSD.mp32022-08-10 12:33 852K 
[SND]jo.mp32022-08-10 12:33 3.2M 
[SND]Blights.mp32022-08-10 12:32 0  
[SND]jk.mp32022-08-10 12:32 0  
[SND]KontolX1.mp32022-08-10 12:32 0  
[SND]MORI.mp32022-08-10 12:29 0  
[SND]Rahmat XxX1.mp32022-08-10 12:28 0  
[SND]yt1s.com - living life in the night ringtonewhatsapp status PABLO BEATS.mp32022-08-10 12:28 0  
[SND]ModeM_-_V_rukakh_avtomat.mp32022-08-10 12:20 0  
[SND]haning.mp32022-08-10 12:19 0  
[SND]lampung.mp32022-08-10 12:19 0  
[SND]basco sellout.mp32022-08-10 12:17 0  
[SND]Anas4.mp32022-08-10 12:17 0  
[SND]Anas3.mp32022-08-10 12:16 0  
[SND]Marcus_-_Senorita_66243016.mp32022-08-10 12:12 0  
[SND]LeonskyXXX1.mp32022-08-10 12:11 0  
[SND]Asw.mp32022-08-10 12:11 4.3M 
[SND]Jancokk.mp32022-08-10 12:09 0  
[SND]altjbreezeblocks.mp32022-08-10 12:09 0  
[SND]LeonskyXXX.mp32022-08-10 12:04 0  
[SND]joji.mp32022-08-10 12:04 2.7M 
[SND]_Allen_GAMMATEP X LilAiNidd.mp32022-08-10 12:03 2.2M 
[SND]lcrpbinibini.mp32022-08-10 12:00 144K 
[SND]sedaya.mp32022-08-10 11:58 0  
[SND]yan9.mp32022-08-10 11:58 5.4M 
[SND]yan6.mp32022-08-10 11:58 8.0M 
[SND]yan8.mp32022-08-10 11:57 3.7M 
[SND]yan7.mp32022-08-10 11:57 4.2M 
[SND]yan3.mp32022-08-10 11:57 5.3M 
[SND]Keep You Safe Yahya.mp32022-08-10 11:57 0  
[SND]yan5.mp32022-08-10 11:57 1.9M 
[SND]yan4.mp32022-08-10 11:57 4.8M 
[SND]yan21.mp32022-08-10 11:56 5.5M 
[SND]yan22.mp32022-08-10 11:56 7.9M 
[SND]yan20.mp32022-08-10 11:56 5.4M 
[SND]yan2.mp32022-08-10 11:56 4.9M 
[SND]yan13.mp32022-08-10 11:56 7.1M 
[SND]yan19.mp32022-08-10 11:55 4.8M 
[SND]yan15.mp32022-08-10 11:55 5.3M 
[SND]yan18.mp32022-08-10 11:55 2.2M 
[SND]yan16.mp32022-08-10 11:55 3.6M 
[SND]yan14.mp32022-08-10 11:55 3.4M 
[SND]yan17.mp32022-08-10 11:55 2.4M 
[SND]yan12.mp32022-08-10 11:55 5.8M 
[SND]yan01.mp32022-08-10 11:55 6.0M 
[SND]yan11.mp32022-08-10 11:55 2.8M 
[SND]yan10.mp32022-08-10 11:55 3.8M 
[SND]yan1.mp32022-08-10 11:54 3.6M 
[SND]yan000.mp32022-08-10 11:54 3.2M 
[SND]yan00.mp32022-08-10 11:54 3.2M 
[SND]yan0.mp32022-08-10 11:54 4.6M 
[SND]Phonk7.mp32022-08-10 11:54 1.1M 
[SND]toge0.mp32022-08-10 11:54 0  
[SND][lagu1s.com]DJ RINDU SEMALAM REMIX VIRAL TIKTOK TERBARU 2022 SEMALAM KU TAHAN KU TAHAN SEMALAM.HoPh8FM0h_E.mp32022-08-10 11:54 0  
[SND]Phonk6.mp32022-08-10 11:54 2.1M 
[SND]Miyagi_JEndshpil_-_BadaBum_70693181.mp32022-08-10 11:54 0  
[SND]Phonk9.mp32022-08-10 11:54 1.8M 
[SND]lcrpmahika.mp32022-08-10 11:54 380K 
[SND]Phonk8.mp32022-08-10 11:54 1.8M 
[SND]Phonk5.mp32022-08-10 11:53 2.2M 
[SND]Phonk4.mp32022-08-10 11:53 1.8M 
[SND]Phonk3.mp32022-08-10 11:53 1.9M 
[SND]Alt-J () _ Breezeblocks Lyrics (HQ).mp32022-08-10 11:53 0  
[SND]𝕐𝒫𝒜人Ѣ𝓒𝓀𝖀𝕌-† - Блатная походка бандит 🍷-kissvk.com.mp32022-08-10 11:52 0  
[SND]rep.mp32022-08-10 11:50 0  
[SND]Phonk2.mp32022-08-10 11:49 2.0M 
[SND]onlymp3.to - Alt-J (∆) _ Breezeblocks Lyrics (HQ)-kT6pFsVA6hA-192k-1660040896941.mp32022-08-10 11:48 652K 
[SND]Phonk1.mp32022-08-10 11:47 1.3M 
[SND]Uta1.mp32022-08-10 11:47 0  
[SND]TOTTO69.mp32022-08-10 11:47 11M 
[SND]TOTTO61.mp32022-08-10 11:47 6.3M 
[SND]TOTTO67.mp32022-08-10 11:47 4.8M 
[SND]DUKH1.mp32022-08-10 11:47 0  
[SND]TOTTO68.mp32022-08-10 11:47 9.7M 
[SND]TTA2.mp32022-08-10 11:47 0  
[SND]SAD2.mp32022-08-10 11:47 0  
[SND]TOTTO70.mp32022-08-10 11:47 8.8M 
[SND]TTA1.mp32022-08-10 11:47 0  
[SND]TOTTO72.mp32022-08-10 11:47 3.2M 
[SND]TOTTO71.mp32022-08-10 11:47 3.3M 
[SND]TOTTO80.mp32022-08-10 11:47 0  
[SND]VANIX.mp32022-08-10 11:47 0  
[SND]sw8.mp32022-08-10 11:46 0  
[SND]sw7.mp32022-08-10 11:45 0  
[SND]sw5.mp32022-08-10 11:45 0  
[SND]sw6.mp32022-08-10 11:45 0  
[SND]Mentahan ccp 30 detik lirik DJ Darkside by alan Walker.mp32022-08-10 11:44 0  
[SND]Ply2.mp32022-08-10 11:44 0  
[SND]𝙙𝙧c3.mp32022-08-10 11:44 0  
[SND]sw4.mp32022-08-10 11:44 0  
[SND]Harble-БЕН x Daycare Theme -FNAF Security Breach OST--kissvk.com.mp32022-08-10 11:43 0  
[SND]alok1.mp32022-08-10 11:42 213K 
[SND]Playboi.mp32022-08-10 11:41 0  
[SND]𝙙𝙧4𝙘𝙤.mp32022-08-10 11:40 0  
[SND]🥀💉Stetex💉🥀-🌪️niko and the niners🌪️-kissvk.com.mp32022-08-10 11:40 0  
[SND]—ʀ ᴀ s т ᴀ ғ ᴀ ʀ ɪ 🌴-Я знаю ты долеко - RMX --kissvk.com.mp32022-08-10 11:39 0  
[SND]🔊💣😈Iliusha🔊💣😈-🌴𝕃𝔼𝕊𝕋𝔻𝕌𝕀𝕋🌴-kissvk.com.mp32022-08-10 11:38 0  
[SND]derevna.mp32022-08-10 11:37 0  
[VID]f9336b6ba13bc84e1892b24f69375c5e.mp42022-08-10 11:37 0  
[SND]y2meta.com - DJ Dash Uciha Plis Ku Tak Suka Preman Slow Tik Tok Remix Terbaru 2021 (DJ Cantik Remix) (320 kbps).mp32022-08-10 11:37 0  
[VID]Video-xin-vinh-biet-cu-www_tiengdong_com.mp42022-08-10 11:36 0  
[SND]bro hayuk mabar bro.mp32022-08-10 11:35 0  
[SND]smsa.mp32022-08-10 11:33 0  
[SND]𝙙𝙧4𝙘𝙤 - 𝙛𝙧𝙖𝙢𝙚𝙙「 𝙨𝙥𝙚𝙙 𝙪𝙥 」.mp32022-08-10 11:29 0  
[SND]herbaltea.mp32022-08-10 11:29 0  
[SND]1657269509300_track.mp32022-08-10 11:27 0  
[SND]Francesco Sartori & Sir James Galway - Time To Say Goodbye (megasongs.me).mp32022-08-10 11:25 0  
[SND]vipusk.mp3.mp32022-08-10 11:25 0  
[SND]snobbism.mp32022-08-10 11:24 0  
[SND]TikTok.mp32022-08-10 11:23 5.0M 
[SND]konfuz-kajf-ty-pojmala-alexei-shkurko-remix-mp3.mp32022-08-10 11:20 0  
[SND]25-meiko.mp32022-08-10 11:20 0  
[SND]LIZER_Moi_ruki_ne_krylya_da_i_lyudi_ne_pticy.mp32022-08-10 11:20 0  
[SND]alex-andreev-gip-y-prince-padal-belyj-sneg.mp32022-08-10 11:20 0  
[SND]Ислам Итляшев - Ой ой ой сердце думай головой (mp3day.net).mp32022-08-10 11:20 0  
[SND]KIRYA_NASVAEV_-_MATIZ_nightcore_bassboost_74153549.mp32022-08-10 11:19 0  
[SND]Zx.mp32022-08-10 11:16 0  
[SND]HerbalTea.mp32022-08-10 11:15 0  
[SND]_Salahkah kita_-robinhood ft asmirandah..mp32022-08-10 11:14 0  
[SND]paa.mp3.mp32022-08-10 11:13 0  
[SND]Ariel.mp32022-08-10 11:11 0  
[SND]Paa Sa Lupa Pilyo Gang Ft JCF.mp32022-08-10 11:10 0  
[SND]ཌ乂卂爪乇尺ད - 𝐒𝐍𝐎𝐖.mp32022-08-10 11:08 0  
[VID]5efada2250010dd06d5bfc8448fedfbc.mp42022-08-10 11:07 0  
[SND]GAYAZOV$ BROTHER$ - СИНИЙ ИНЕЙ.mp32022-08-10 11:04 0  
[SND]sktzxx.mp32022-08-10 11:03 0  
[SND]TUG.mp32022-08-10 11:00 0  
[VID]8e178bc25390c1107022f148bb786f2e.mp42022-08-10 10:59 0  
[SND]lkdj.mp32022-08-10 10:55 0  
[SND]Üsma.m4a2022-08-10 10:48 0  
[SND]MATRANG - ПАТРИАРХАТ (1).mp32022-08-10 10:48 848K 
[SND]Vip4.mp32022-08-10 10:48 3.8M 
[SND]ilham10.mp32022-08-10 10:47 2.8M 
[SND]Masteran 1 jam untuk murai batu isian lengkap.mp32022-08-10 10:45 0  
[SND]ลลา นกบนหลาดง White-rumped shama Display.mp32022-08-10 10:44 452K 
[SND]BUDOTS.mp32022-08-10 10:44 15M 
[SND]Suara pikat burung sertu 100 ampuh!!! Dan memancing sertu yg macet bunyi.mp32022-08-10 10:44 0  
[SND]Masteran Favorit Murai Batu Suara Burung 3 In 1. Tengkek Buto, Cililin, Kapas Tembak.mp32022-08-10 10:44 0  
[SND]sw3.mp32022-08-10 10:43 0  
[SND]ChuChu TV Baby Shark - Good Habits and Many More Videos Popular Nursery Rhymes Collection.mp32022-08-10 10:43 0  
[SND]Ne2.mp32022-08-10 10:42 0  
[SND]Suara burung cipohsirtu cocok buat mancing jantan.mp32022-08-10 10:42 0  
[SND]Johny Johny Yes Papa Ball Pit Show - ChuChu TV 3D Baby Songs & Nursery Rhymes for Kids.mp32022-08-10 10:42 0  
[SND]sw2.mp32022-08-10 10:42 0  
[SND]Baby goes to Old MacDonalds Farm + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:41 0  
[SND]10AGE_-_Malyshka_74140548.mp32022-08-10 10:41 0  
[SND]Baby's Humpty Dumpty Song + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:40 0  
[SND]Andery_Toronto_Diman_Bryukhanov_-_Karavan_73442350.mp32022-08-10 10:40 0  
[SND]Pat a Cake + Many more Nursery Rhymes &amp Kids Songs - ChuChu TV LIVE.mp32022-08-10 10:40 0  
[SND]Happy Kid's Cartoon Music Background.mp32022-08-10 10:39 0  
[SND]Funny Kids Children's Music (Instrumental Music For Kids).mp32022-08-10 10:39 0  
[SND]Cute Background Music for Videos - Cute Little Tikes Kids Song by Happy Face Music.mp32022-08-10 10:39 0  
[SND]ChuChu TV Classics - Let's Learn The Colors! Nursery Rhymes and Kids Songs.mp32022-08-10 10:39 0  
[SND]Bath Song 2 + More ChuChu TV Baby Nursery Rhymes & Kids Songs.mp32022-08-10 10:39 0  
[SND]ChuChu TV Classics - Head Shoulders Knees & Toes Dance Song Nursery Rhymes and Kids Songs.mp32022-08-10 10:38 0  
[SND]Soft Relaxing Baby Sleep Music Best Bedtime Lullabies For Toddlers Good Night Sweet Dreams.mp32022-08-10 10:38 0  
[SND]Lullabies For Kids - Sleep Baby Nursery Rhymes and Kids Songs Baby Songs Little Baby Bum.mp32022-08-10 10:37 0  
[SND]k5Ax.mp32022-08-10 10:37 1.1M 
[SND]DJ-Sikok-Bagi-Duo-Tik-Tok-Remix-Terbaru-2022-DJ-Cantik-Remix_a3cS7dQCKGI.mp32022-08-10 10:36 0  
[SND]Bath Song 2 - ChuChu TV Nursery Rhymes & Kids Songs.mp32022-08-10 10:36 0  
[SND]Siti Nurhaliza - Aisyah Istri Rasulullah ( Cover ).mp32022-08-10 10:35 0  
[SND]SABYAN - AISYAH ISTRI RASULULLAHCOVER.mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH - ANISA RAHMAN (Cover).mp32022-08-10 10:35 0  
[SND]Aisyah Istri Rasulullah (cover by Sheryl Shazwanie).mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH - PUTIH ABU ABU COVER.mp32022-08-10 10:35 0  
[SND]AISYAH ISTRI RASULULLAH COVER BY BABY SHIMA.mp32022-08-10 10:34 0  
[SND]Aisyah Istri Rasulullah versi Upin Ipin Terbaru 2020.mp32022-08-10 10:34 0  
[SND]ash.mp32022-08-10 10:33 3.3M 
[SND]Ne3.mp32022-08-10 10:32 0  
[VID]Vp7.mp42022-08-10 10:21 0  
[SND]Tokyo Drift (Fast & Furious).mp32022-08-10 10:16 564K 
[SND]Dajj.mp32022-08-10 10:14 0  
[SND]dejj.mp32022-08-10 10:14 0  
[SND]Manifest.mp32022-08-10 10:12 3.4M 
[SND]Mr. Bill Collector.m4a2022-08-10 10:11 0  
[SND]luckydj.mp32022-08-10 10:09 0  
[SND]MORGENSHTERN, The Limba, NILETTO, Boombl4 - СКОЛЬКО СТОИТ ЛЮБОВЬ.mp32022-08-10 10:05 0  
[SND]NIGHTMORSS - SECRET.mp32022-08-10 10:05 0  
[SND]MORGENSHTERN - Домой.mp32022-08-10 10:05 0  
[SND]Surf Curse - Freaks (Slowed Down).mp32022-08-10 10:05 0  
[SND]Kordhell - Scopin.mp32022-08-10 10:05 3.9M 
[SND]ЯМАУГЛИ - ТАРАНТИНО.mp32022-08-10 10:05 0  
[SND]Cyrus312 - Horny nigga detected.mp32022-08-10 10:05 0  
[SND]Kaito Shoma - konfuz x kaito.mp32022-08-10 10:05 0  
[SND]Maulana-Ardiansyah-Dermaga-Biru-Live-Ska-Reggae_Og6_0laepzM.mp32022-08-10 10:03 0  
[SND]DERMAGA-BIRU-Thomas-Arya-Cover-Sasa-Official_eXPdhMDKHFY.mp32022-08-10 10:03 0  
[SND]Dermaga-Biru-Thomas-Arya-cover-Literasi-60-Detik-by-AA-Kacif_Va1F0ydiHoI.mp32022-08-10 10:03 0  
[SND]Vikram - Rolex BGM.mp32022-08-10 10:00 0  
[SND]Get Out Of My Way - KGF 2 ! Remix.mp32022-08-10 10:00 0  
[SND]Chirakukal-Mulakkuvan(PagalWorld).mp32022-08-10 10:00 0  
[SND]chekuthan_kalame_poyidam.mp32022-08-10 10:00 0  
[SND]Kaadhal-En-Kaviye-MassTamilan.dev.mp32022-08-10 09:59 0  
[SND]y2mate.com - Suzume no Tojimari.mp32022-08-10 09:58 0  
[SND]rafy-glaza-mp3 (1).mp32022-08-10 09:56 0  
[SND]ENZO MF - BANDO feat. Nateman (Official Music Video).mp32022-08-10 09:56 0  
[SND]gsuqkxj.mp32022-08-10 09:54 0  
[SND]X2Download.app - បទថ្មីកំពុងល្បីក្នុង Tik tok 🎬🎼 New Songs by Chan Studio 🎬🎶🎞️ (128 kbps).mp32022-08-10 09:53 0  
[SND]carlruploadmusic1.mp32022-08-10 09:53 0  
[SND]Y2Mate.is - Thundercat - 'Tron Song'-XYGEEa4Qcis-160k-1660125036692.mp32022-08-10 09:50 0  
[SND]get.mp32022-08-10 09:48 0  
[SND]loveann.mp32022-08-10 09:48 0  
[SND]WSHL.mp32022-08-10 09:44 0  
[SND]DCM.mp32022-08-10 09:43 0  
[SND]HAPPY.mp32022-08-10 09:42 3.0M 
[SND]Макс Корж - Малиновый закат.mp32022-08-10 09:42 0  
[SND]DSAAC.mp32022-08-10 09:40 0  
[SND]Slava_-_YA_i_ty_52551041.mp32022-08-10 09:36 0  
[SND]SION Rework Voce Italiana -SION Rework Voice ITA 2014 (mp3cut.net).m4a2022-08-10 09:36 0  
[SND]mp50.mp32022-08-10 09:34 0  
[SND]ken.mp32022-08-10 09:34 0  
[SND]Troye.m4a2022-08-10 09:31 0  
[SND]SUPIAR OTO - D'ROC'K (Official Music Video) (1).mp32022-08-10 09:29 0  
[SND]seboy.mp32022-08-10 09:26 0  
[SND]TUT.mp32022-08-10 09:26 0  
[SND]KAS.mp32022-08-10 09:25 0  
[SND]anime.mp32022-08-10 09:25 0  
[SND]ASK.mp32022-08-10 09:25 2.9M 
[SND]REMIX1.mp32022-08-10 09:25 3.2M 
[SND]Geometry Dash - SLAUGHTERHOUSE_(MP3Ball.ru).mp32022-08-10 09:23 0  
[SND]MORGENSHTERN, Элджей - Cadillac.mp32022-08-10 09:23 6.8M 
[SND]Molchat_Doma_-_Na_dne_58595703.mp32022-08-10 09:22 0  
[SND]Mil.mp32022-08-10 09:20 0  
[SND]inginusai.mp32022-08-10 09:19 0  
[SND]morgenshtern-feat-eldzhey-cadillac.mp32022-08-10 09:15 0  
[SND]dgt12.mp32022-08-10 09:15 0  
[SND]Bakit.mp32022-08-10 09:15 0  
[SND]какашка pou - игры для всей семьи (1).mp32022-08-10 09:14 0  
[SND]zm1.mp32022-08-10 09:12 44K 
[SND]11678.mp32022-08-10 09:09 0  
[SND]Bugoy.mp32022-08-10 09:07 2.7M 
[SND]jakone_-_kurit__(feat._a.v.g__itachi)_muzati.net.mp32022-08-10 09:06 0  
[SND]NOBITA - IKAW LANG _ Official Lyric Video.mp32022-08-10 08:53 4.0M 
[SND]Because - Marlboro Black.mp32022-08-10 08:53 0  
[SND]Al James - Pahinga (Official Audio).mp32022-08-10 08:53 0  
[SND]Pagsamo - Arthur Nery (Official Music Video).mp32022-08-10 08:53 0  
[SND]Al James - Pa-umaga.mp32022-08-10 08:53 0  
[SND]December Avenue - Huling Sandali (OFFICIAL LYRIC VIDEO).mp32022-08-10 08:53 0  
[SND]Munimuni - Bawat Piyesa (Official Lyric Video).mp32022-08-10 08:53 0  
[SND]Adie - Paraluman (Official Audio).mp32022-08-10 08:53 0  
[SND]727 Clique - Family Day.mp32022-08-10 08:53 0  
[SND]Joji - Sanctuary (Official Video).mp32022-08-10 08:53 2.9M 
[SND]Joji - SLOW DANCING IN THE DARK.mp32022-08-10 08:53 0  
[SND]Munimuni - Sa Hindi Pag-alala (Lyric Video).mp32022-08-10 08:53 0  
[SND]PARASITIKO - Jrldm ft. Lexus (Official Music Video).mp32022-08-10 08:53 0  
[SND]Akala Mo Ata (OMV) - Nateman x Realest Cram x CK YG (Dir. by Lua Swish).mp32022-08-10 08:53 0  
[SND]Akala Mo Ata (feat. Nateman, Realest Cram & CK YG).mp32022-08-10 08:53 0  
[SND]Paraluman sad version.mp32022-08-10 08:53 0  
[SND]UNIQUE - Sino (Official Music Video).mp32022-08-10 08:53 0  
[SND]Fenn7.mp32022-08-10 08:52 0  
[SND]lambi-judai.mp32022-08-10 08:45 0  
[SND]kewer1.mp32022-08-10 08:45 0  
[SND]zara-sa.mp32022-08-10 08:40 0  
[SND]AA.mp32022-08-10 08:38 80K 
[SND]Rex Orange County - THE SHADE (Official Audio).mp32022-08-10 08:32 0  
[SND]Fenn9Athecraz1.mp32022-08-10 08:31 2.8M 
[SND]djj1.mp32022-08-10 08:17 3.3M 
[SND]Zhu Ni Shengri Kuai Le- Happy Birthday Mandarin Chinese Kid Song Lyrics.mp32022-08-10 08:17 0  
[SND]dj4.mp32022-08-10 08:16 480K 
[SND]A.L.A - Piano (feat. Didine Canon 16).mp32022-08-10 08:08 0  
[SND]NAAN JACKSON.mp32022-08-10 08:07 0  
[SND]Made3.mp32022-08-10 08:07 0  
[SND]Made2.mp32022-08-10 08:07 0  
[SND]Made1.mp32022-08-10 08:07 0  
[SND]OPPANA SONG,.mp32022-08-10 08:04 0  
[SND]POORAM KANAN DJ.mp32022-08-10 08:03 0  
[SND]y2meta.com - VIET DEEP 2022 - HOUSE LAK CHILL ĐI BẠN ƠI, VIỆT MIX 2022 - SET NHẠC CHILL (128 kbps).mp32022-08-10 08:02 44K 
[SND]Fennfenn1.mp32022-08-10 08:02 0  
[SND]FennFenn1.mp32022-08-10 08:00 0  
[SND]Seafret - Atlantis (Lyrics).mp32022-08-10 07:59 0  
[SND]sulthan.mp32022-08-10 07:59 0  
[SND]SHA.mp32022-08-10 07:59 0  
[SND]Ezra6.mp32022-08-10 07:59 0  
[SND]Los.mp32022-08-10 07:58 0  
[SND]Ed Sheeran - Photograph (Official Music Video).mp32022-08-10 07:57 0  
[SND]sulthan 1.mp32022-08-10 07:56 0  
[SND]Vel.mp32022-08-10 07:55 0  
[SND]Nicky Youre, dazy - Sunroof (Official Music Video).mp32022-08-10 07:52 2.7M 
[SND]a505.mp32022-08-10 07:47 0  
[SND]SARJANA.mp32022-08-10 07:39 0  
[SND]ligaw.mp32022-08-10 07:39 104K 
[SND]DjFenn1.mp32022-08-10 07:39 1.1M 
[SND]DjFenn2.mp32022-08-10 07:38 3.0M 
[SND]hohey.mp32022-08-10 07:29 140K 
[SND]glassanimals.mp32022-08-10 07:29 0  
[SND]djthailand.mp32022-08-10 07:29 0  
[SND]middle of night.mp32022-08-10 07:29 2.8M 
[SND]man.mp32022-08-10 07:28 4.2M 
[SND]Bentot.mp32022-08-10 07:27 0  
[SND]ZX.mp32022-08-10 07:26 0  
[SND]badcurt-kert-ya-tebya-lyublyu-mp3.mp32022-08-10 07:26 0  
[SND]typeluv-poslan.mp32022-08-10 07:24 0  
[SND]Marikit.mp32022-08-10 07:00 0  
[SND]Baak_Gmlcineliolu_-_Bir_Anda_73825968.mp32022-08-10 06:49 0  
[SND]blls3.mp32022-08-10 06:39 0  
[SND]:)).mp32022-08-10 06:30 0  
[SND]Troye.mp32022-08-10 06:29 3.1M 
[SND]Xcho_Mr_Lambo_-_Zakryla_dal_74291179.mp32022-08-10 06:27 0  
[SND]tonggiavy.mp32022-08-10 06:27 0  
[SND]MOLLBEN37.mp32022-08-10 06:16 2.8M 
[SND]itoangliga.mp32022-08-10 06:11 3.2M 
[SND]euphoria.mp32022-08-10 06:10 0  
[SND]Demeter_Discoteka.mp32022-08-10 06:02 0  
[SND]RAIKAHO - Психопат.mp32022-08-10 06:01 0  
[SND]HTRCP1.mp32022-08-10 06:00 0  
[SND]dhhje.mp32022-08-10 05:59 0  
[SND]Instrumen Sedih, Instrumen Musik paling Sedih, Instrumen Sedih Bikin Nangis.mp32022-08-10 05:59 0  
[SND]bsata.mp32022-08-10 05:57 0  
[SND]pasaway.mp32022-08-10 05:57 0  
[SND]PSYCHEDELIC BOYZ - RAWSTARR TIL I DIE (BATANG PASAWAY)_160k.mp32022-08-10 05:55 0  
[SND]Rawr8.mp32022-08-10 05:55 0  
[SND]Tekiteki.mp32022-08-10 05:54 0  
[SND]mabagal.mp32022-08-10 05:54 0  
[SND]munimuni.mp32022-08-10 05:54 0  
[SND]Lily of The Valley.mp32022-08-10 05:53 328K 
[SND]papel.mp32022-08-10 05:53 5.8M 
[SND]xinmaruocdau.mp32022-08-10 05:52 0  
[SND]kadhal.mp32022-08-10 05:52 0  
[SND]Kannil.mp32022-08-10 05:51 0  
[SND]Rabbane.mp32022-08-10 05:51 0  
[SND]Lilyofthevalley.m4a2022-08-10 05:49 0  
[SND]ghbd.mp32022-08-10 05:41 2.9M 
[SND]bg.mp32022-08-10 05:39 8.2M 
[SND]AleksMarty_Corrosive.mp32022-08-10 05:38 2.2M 
[SND]Za.mp32022-08-10 05:38 4.0M 
[SND]botsurpdj12.mp32022-08-10 05:38 0  
[SND]FERDZ X ELLA EYS X PACHO - SUNDO (COSA NOSTRA I OST).mp32022-08-10 05:37 0  
[SND]Tetap Dalam Jiwa.mp32022-08-10 05:32 0  
[SND]WENAKK.mp32022-08-10 05:30 0  
[SND]Audioghh.mp32022-08-10 05:27 0  
[SND]ferdzapelyido.mp32022-08-10 05:22 0  
[SND]requestferdz.mp32022-08-10 05:21 0  
[SND]mr7.mp32022-08-10 05:20 3.3M 
[SND]gk tau.mp32022-08-10 05:20 0  
[SND]za.mp32022-08-10 05:19 0  
[SND]fmhdlg.mp32022-08-10 05:19 3.2M 
[SND]DJ ENAKEUNN V4 X MAMA BALE BALE VINKY YT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI !.mp32022-08-10 05:16 0  
[SND]mr5.mp32022-08-10 05:16 3.2M 
[SND]frdz.mp32022-08-10 05:14 756K 
[SND]mr4.mp32022-08-10 05:12 3.1M 
[SND]mr3.mp32022-08-10 05:07 2.8M 
[SND]mr2.mp32022-08-10 05:02 2.7M 
[SND]joby101.mp32022-08-10 04:56 892K 
[SND]Jeydii.mp32022-08-10 04:55 752K 
[SND]mr1.mp32022-08-10 04:54 4.6M 
[SND]ulap.mp32022-08-10 04:52 0  
[SND]yellow.mp32022-08-10 04:52 3.2M 
[SND]bmw.mp32022-08-10 04:51 0  
[SND]pano.mp32022-08-10 04:51 3.9M 
[SND]sanctuary.mp32022-08-10 04:50 2.8M 
[SND]somebody.mp32022-08-10 04:50 2.2M 
[SND]pasko.mp32022-08-10 04:43 0  
[SND]Bahanapui.mp32022-08-10 04:40 0  
[SND]sjdajd.mp3.mp32022-08-10 04:38 0  
[SND]Cf.mp32022-08-10 04:32 0  
[SND]SAO.mp32022-08-10 04:28 0  
[SND]Seinpogi.mp32022-08-10 04:22 0  
[SND]Wanna.mp32022-08-10 04:21 3.1M 
[SND]y2mate.com - The Walters I Love You So_320kbps.mp32022-08-10 04:18 0  
[SND]Callip12.mp32022-08-10 04:17 0  
[SND]music2.mp32022-08-10 04:08 108K 
[SND]GASAGA.mp32022-08-10 04:07 348K 
[SND]Suzume-no-Tojimari-Trailer-2-SONG-Suzume-Nanoka-Hara-Lyrics-KAN-ROM-ENG_RO2mt82300Q.mp32022-08-10 03:59 0  
[SND]music1.mp32022-08-10 03:57 3.8M 
[SND]Kiyo x Because - Ano na [Slow remix] PROD. SHORTONE.mp32022-08-10 03:55 0  
[SND]Shanti Dope - Nadarang (Official Music Video).mp32022-08-10 03:50 0  
[SND]Lo ki - Munting Paraiso (Lyrics).mp32022-08-10 03:50 0  
[SND]Lo Ki - Kagome (Official Music Video).mp32022-08-10 03:50 3.7M 
[SND]VAR.mp32022-08-10 03:49 0  
[SND]Dre Dog - Smoke Dope and Rap.mp32022-08-10 03:46 0  
[SND]TEN1.mp32022-08-10 03:38 0  
[SND]bla.mp32022-08-10 03:36 0  
[SND]pln.mp32022-08-10 03:32 1.6M 
[SND]IMG_1243.MOV.mp32022-08-10 03:27 0  
[SND]Hiling.mp32022-08-10 03:22 4.5M 
[SND]AUD-20220605-WA0046.mp32022-08-10 03:20 0  
[SND]AUD-20220314-WA0050.m4a2022-08-10 03:20 0  
[SND]АСТМА 3..mp32022-08-10 03:18 0  
[SND]Line.mp32022-08-10 03:15 3.8M 
[SND]Lambi Judai 128 Kbps.mp32022-08-10 03:15 0  
[SND] Zara Sa.mp32022-08-10 03:11 0  
[SND]JhoNT2.mp32022-08-10 03:04 0  
[VID]Better Call Saul - Chuck loses control.mp42022-08-10 03:01 0  
[SND]Cheriimoya_feat._Sierra_Kidd_feat._55_-_living_life_in_the_night_(Gybka.com).mp32022-08-10 02:51 0  
[SND]TAKBO.mp32022-08-10 02:51 0  
[SND]Zachem_mne_solnce_v_Monako_polnaya_versiya_-_Pesnya_73364115.mp32022-08-10 02:51 0  
[SND]LoOk aT aLL tHoSe ElVeS.mp32022-08-10 02:47 0  
[SND]Lil_Nas_X_-_Panini_Official_Video.mp32022-08-10 02:40 0  
[SND]Man Screaming CEEDAY Sound Effect HD.mp32022-08-10 02:38 0  
[SND]CaWa - Balenciaga (www.hotplayer.ru).mp32022-08-10 02:38 0  
[SND]mp3-now.com - Mick Gordon The Only Thing They Fear Is You DOOM Eternal OST High Quality 2020.mp32022-08-10 02:38 0  
[SND]Home_With_Hope.mp32022-08-10 02:36 0  
[SND]The Only Thing They Fear Is You ( DOOM Eternal OST High Quality 2021 MICK GORDON).mp32022-08-10 02:34 0  
[SND]dj8.mp32022-08-10 02:30 504K 
[SND]8mb.video-n8U-RPTnuLjT.mp32022-08-10 02:30 0  
[SND]RTX.mp32022-08-10 02:27 0  
[SND]WhatsApp Audio 2022-08-09 at 3.22.21 PM.mp32022-08-10 02:26 0  
[SND]TLT.mp32022-08-10 02:25 0  
[SND]behind_the_chimney_DEMO_29-5-22_2-1.mp32022-08-10 02:23 0  
[SND]WhatsApp Audio 2022-08-10 at 09.17.47.mp32022-08-10 02:19 0  
[SND]CHOP.mp32022-08-10 02:17 0  
[SND]ajpanalo.mp32022-08-10 02:17 0  
[SND]dj7.mp32022-08-10 02:15 504K 
[SND]dj5.mp32022-08-10 02:15 424K 
[SND]DAK.mp32022-08-10 02:15 4.2M 
[SND]Aisyah.mp32022-08-10 02:13 3.6M 
[SND]intropanalo.mp32022-08-10 02:13 0  
[SND]Turu.mp32022-08-10 02:12 732K 
[SND]Jopay.mp32022-08-10 02:11 4.1M 
[SND]Hmmm.mp32022-08-10 01:42 0  
[SND]Sadboy.mp32022-08-10 01:41 1.1M 
[SND]ecan.mp32022-08-10 01:38 0  
[SND]thangcam.mp32022-08-10 01:33 0  
[SND]Staring at Stars.mp32022-08-10 01:33 0  
[VID]Tastelike Cake - Starring at stars ( Dream Piano Song ).mp42022-08-10 01:30 0  
[SND]Rn17.mp32022-08-10 01:27 0  
[SND]inbound833631831458767416.mp32022-08-10 01:26 0  
[SND]poyuya.mp32022-08-10 01:23 0  
[SND]ngoisaocodon.mp32022-08-10 01:21 0  
[SND]mp2.mp32022-08-10 01:20 3.0M 
[SND]bensound-buddy.mp32022-08-10 01:17 0  
[SND]Musik.mp32022-08-10 01:15 0  
[SND]y2mate.com - ささえる人の歌 back number.mp32022-08-10 01:14 0  
[SND]unwell.mp32022-08-10 01:13 0  
[SND]1575866702_korol_i_shut_vospominaniya_o_byloy_lyubvi.mp32022-08-10 01:11 0  
[SND]SAFESAFE.mp32022-08-10 01:06 0  
[SND]Central Cee Doja Directed by Cole Bennett_2.mp32022-08-10 01:05 0  
[SND]Tokyo Drift - Teriyaki Boyz [ MUSIC VIDEO ] HD.mp32022-08-10 01:03 3.9M 
[SND]Daun Jatuh - Resah Jadi Luka (Official Audio).mp32022-08-10 01:03 0  
[SND]seandainya - vierra (slowed reverb lyrics).mp32022-08-10 01:03 0  
[SND]LAST CHILD - BERNAFAS TANPAMU (Lirik Lyric).mp32022-08-10 01:03 0  
[SND]Covidv.mp32022-08-10 01:02 0  
[SND]covidvibes.mp32022-08-10 01:00 0  
[SND]hey_loser_you_scared_yes.mp32022-08-10 00:49 0  
[VID]VID_20220810015523.mp42022-08-10 00:41 0  
[SND]y2mate.com - Story Wa Anime AOT Lagu Sasageyo.mp32022-08-10 00:24 0  
[SND]Vyacheslav Mescherin Orchestra - Frogs.mp32022-08-10 00:13 0  
[SND]AUD-20220804-WA0000.mp32022-08-09 23:57 0  
[SND]Al_Bakara.mp32022-08-09 23:55 0  
[SND]Sura_2_Al-Bakara_Korova_-_Korana_na_arabskom_s_perevodom_na_russkij_yazyk._(iPleer.com).mp32022-08-09 23:51 0  
[SND]Fireboy_DML_ft_Asake_-_Bandana_AstroBaze.com.mp32022-08-09 23:32 0  
[SND]Fireboy_DML_-_Change_AstroBaze.com.mp32022-08-09 23:30 0  
[SND]vp11.mp32022-08-09 23:28 0  
[SND]kanjut.mp32022-08-09 23:25 0  
[VID]Vp1.mp42022-08-09 23:13 0  
[SND]Y2Mate.is - Indila - Tourner Dans Le Vide-vtNJMAyeP0s-160k-1660086324721.mp32022-08-09 23:06 0  
[SND]vs3.mp32022-08-09 22:55 0  
[SND]vs2.mp32022-08-09 22:54 0  
[SND]vs1.mp32022-08-09 22:54 0  
[SND]Юлия_Савичева_Не_смотри_PHONK_EDITION_BY_KINEZIS.mp32022-08-09 22:53 1.2M 
[SND]one direction - strong.mp32022-08-09 22:42 0  
[SND]قراءة منظومة الزمزمي_ _للقارئ علي صلاح عمر_ مركز تكوين المفسر.mp32022-08-09 22:29 0  
[VID]carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_smnQolF2.mp42022-08-09 22:19 0  
[SND]tian1.mp32022-08-09 22:12 0  
[SND]teste.mp32022-08-09 22:12 44K 
[SND]Sc3.mp32022-08-09 22:10 2.7M 
[SND]Derya Uluğ - Kanunlar Gibi (Mert Kurt Remix).mp32022-08-09 22:05 0  
[VID]carlos-vives-ft-shakira-la-bicicleta-by-elin-manny-ens-letra_MwoYl7Yg.mp42022-08-09 22:03 0  
[SND]toro1.mp32022-08-09 21:55 4.1M 
[SND]OVERTIME ROUGH DRAFT (working on).mp32022-08-09 21:53 4.7M 
[SND]Rainy Day yes vocals first mix (online-audio-converter.com)(2).mp32022-08-09 21:50 0  
[SND]Neck_Deep_-_December(128k).mp32022-08-09 21:48 0  
[SND]logingnlrp.mp32022-08-09 21:48 0  
[SND]IShowSpeed - Shake (Official Music Video).mp32022-08-09 21:44 0  
[SND]one-shot-a-la-conquete_456239046.mp32022-08-09 21:44 0  
[SND]loginlrp.m4a2022-08-09 21:42 420K 
[SND]Adur.mp32022-08-09 21:42 2.2M 
[SND]Grey.mp32022-08-09 21:39 2.9M 
[SND]Самурай.mp32022-08-09 21:25 0  
[SND]mp3-now.com - Eminem Dr Dre 50 Cent Crack A Bottle Official Video.mp32022-08-09 21:25 0  
[SND]CALLX_9-8-2022_21-49-21_01096076324.mp32022-08-09 21:25 0  
[SND]INSTASAMKA_-_moneyken-love.mp32022-08-09 21:18 0  
[SND]Scally_Milano_163ONMYNECK_-_Swag_73511571.mp32022-08-09 21:16 0  
[SND]wshr1.mp32022-08-09 21:05 0  
[SND]ER3.mp32022-08-09 21:04 0  
[SND]ER2.mp32022-08-09 21:03 0  
[SND]Myusl_-_Kurwa_Bobr_74481210.mp32022-08-09 20:55 0  
[SND]oo.mp32022-08-09 20:51 1.7M 
[SND]BB8.mp32022-08-09 20:51 0  
[SND][YT2mp3.info] - Arctic Monkeys - Do I Wanna Know_ (Official Video) (320kbps).mp32022-08-09 20:42 0  
[SND]Sting_money_Audio_425507.mp32022-08-09 20:35 0  
[SND]Batu2.mp32022-08-09 20:32 0  
[SND]Batu1.mp32022-08-09 20:32 8.0M 
[SND]ii.mp32022-08-09 20:22 4.5M 
[SND]MyBandaMiyagi.mp32022-08-09 20:11 3.7M 
[SND]SANTUY.mp32022-08-09 20:10 2.7M 
[SND]Selamat Pagi Dunia Tipu Tipu.mp32022-08-09 20:09 0  
[SND]DeadList1.mp32022-08-09 20:08 0  
[SND]DvLidhouse.mp32022-08-09 20:06 0  
[SND]DJ GO SAMPE BAWAH OMO KUCRUT VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp32022-08-09 20:03 0  
[SND]NangDumatingKa.mp32022-08-09 20:03 0  
[SND]MiyaGi_My_Banda_[www.UZmir.net].mp32022-08-09 20:01 0  
[SND]DDTrack.mp32022-08-09 19:58 0  
[SND]Nang Dumating Ka - Bandang Lapis (Official Lyric Video).mp32022-08-09 19:57 0  
[SND]MiyaGi & Эндшпиль & МанТана - Моя Банда [www.UZmir.net].mp32022-08-09 19:55 0  
[SND]ENIGMA - CAMRY 3.5 (slow remix) (www.hotplayer.ru).mp32022-08-09 19:51 0  
[SND]NDMK.mp32022-08-09 19:47 0  
[SND]mimpi.mp32022-08-09 19:43 2.6M 
[SND]lagimuah.mp32022-08-09 19:42 0  
[SND]Чистое Небо - Гитара 16 (1).mp32022-08-09 19:35 0  
[SND]Павел Пламенев - Эй мёртвый! Проснись! (акустика).mp32022-08-09 19:33 0  
[SND]Wonder.mp32022-08-09 19:29 0  
[SND]Miracle.mp32022-08-09 19:25 0  
[SND]Crazier.mp32022-08-09 19:20 284K 
[SND]Cutie.mp32022-08-09 19:15 2.6M 
[SND]Ako.mp32022-08-09 19:13 0  
[SND]sforek.mp32022-08-09 19:11 0  
[SND]sax.mp32022-08-09 19:08 0  
[SND]tulok.mp32022-08-09 19:08 0  
[SND]Might.mp32022-08-09 19:07 0  
[SND]CHABAH2 (درجة الصوت -0.05 - سرعة إيقاع 103).mp32022-08-09 19:06 0  
[SND]mrv01.mp32022-08-09 19:05 0  
[SND]gimn-sssr-rossii-instrumentalnaya-zapis.mp32022-08-09 19:04 4.7M 
[SND]CHABAH2.mp32022-08-09 19:03 0  
[SND]mrv.mp32022-08-09 19:00 0  
[SND]TIOO.mp32022-08-09 18:56 0  
[SND]Tioosj.mp32022-08-09 18:56 0  
[SND]ning1.mp32022-08-09 18:52 0  
[SND]ning2.mp32022-08-09 18:52 0  
[SND]ning3.mp32022-08-09 18:52 0  
[SND]ning5.mp32022-08-09 18:51 0  
[SND]ning4.mp32022-08-09 18:51 0  
[SND]ssstik.io_1657432160661.mp32022-08-09 18:51 0  
[SND]Dj Bbhc Pyramid.mp32022-08-09 18:51 0  
[SND]rz1.mp32022-08-09 18:50 0  
[SND]SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps) (1).mp32022-08-09 18:50 0  
[SND]SaveTube.App - Eiyuu (Ultraman Nexus Operning) Lyrics (128 kbps).mp32022-08-09 18:49 0  
[SND]JElektroforez_-_505_Legko_sojjti_s_uma_72662961.mp32022-08-09 18:48 0  
[SND]fenicks.mp32022-08-09 18:47 0  
[SND]Bones - Timberlake (ft. Juicy J).mp32022-08-09 18:47 0  
[SND]FelixVander.mp32022-08-09 18:44 5.9M 
[SND]grave!.mp32022-08-09 18:39 3.3M 
[SND]Koy.mp32022-08-09 18:37 8.9M 
[SND]N4.mp32022-08-09 18:33 0  
[SND]Record (online-voice-recorder.com).mp32022-08-09 18:30 0  
[SND]Not Around - Nova.mp32022-08-09 18:30 0  
[SND]touch.mp32022-08-09 18:28 3.5M 
[SND]1515401487_gazirovka-black-www_muzonov_net.mp32022-08-09 18:28 0  
[SND]hamd.mp32022-08-09 18:27 0  
[SND]dqsng.mp32022-08-09 18:27 0  
[SND]hehe.mp32022-08-09 18:27 0  
[SND]1096.mp32022-08-09 18:25 0  
[SND]ᴘᴏ_ᴋᴀɪꜰᴜ_🍷_кайфуша'_🤤✌🏿_Мастер_И_Маргарита(1).mp32022-08-09 18:24 0  
[SND]walwal.mp32022-08-09 18:24 6.3M 
[SND]Sohigh.mp32022-08-09 18:24 0  
[SND]KRK FtNA Official MV Prod By Sakarin.mp32022-08-09 18:20 0  
[SND]So High.mp32022-08-09 18:17 0  
[SND]Bruno Mars, Anderson .Paak, Silk Sonic - Smokin Out The Window.mp32022-08-09 18:17 0  
[SND]zhalan-dunie-zhalan-eken.mp32022-08-09 18:15 0  
[SND]Suzume.mp32022-08-09 18:15 0  
[SND]Сектор Газа - ЛИРИКА PHONK EDITION PROD NERONUS (mp3-2020.com).mp32022-08-09 18:14 0  
[SND]jackmafia100.mp32022-08-09 18:13 0  
[SND]Press2pNick - John Muir.mp32022-08-09 18:13 0  
[SND]djhie1.mp32022-08-09 18:12 0  
[SND]Tulus - Monokrom - sped up.mp32022-08-09 18:12 0  
[SND]zhalan-dunie-zhalan-eken_(muzzona.kz).mp32022-08-09 18:11 0  
[SND]Malaak_Op.mp32022-08-09 18:11 0  
[SND]Mlk_1.mp32022-08-09 18:10 448K 
[SND]DJ CLOSE YOUR EYES X GAM GAM TEKI TEKI VIRAL TIKTOK‼️DJ TIKTOK REMIX VIRAL 2022‼️.mp32022-08-09 18:05 4.0M 
[SND]Тима Белорусских - Знаток.mp32022-08-09 18:05 7.1M 
[SND]FelixGans.mp32022-08-09 18:04 31M 
[SND]Sc2.mp32022-08-09 18:04 3.6M 
[SND]Sc1.mp32022-08-09 18:04 3.2M 
[SND]Hujan.mp32022-08-09 18:04 1.7M 
[SND]dora-doradura-mp3 (1).mp32022-08-09 17:57 0  
[SND]MAHIKA.mp32022-08-09 17:55 3.1M 
[SND]modern-talking-cheri-cheri-lady.mp32022-08-09 17:54 0  
[SND]helmandj7.mp32022-08-09 17:53 3.3M 
[SND]ЧЁРНЫЕ ГЛАЗА - (phonk edition) (mp3day.net).mp32022-08-09 17:51 0  
[SND]helmandj8.mp32022-08-09 17:51 0  
[SND]Seinsong.mp32022-08-09 17:49 0  
[SND]10467-irina-kairatovna-shiza-kok-tu.mp32022-08-09 17:48 0  
[SND]X2Download.app - PtrpStudio - ชอบเธออะ (Prod by. Sakarin) (128 kbps).mp32022-08-09 17:46 0  
[SND]Sein1.mp32022-08-09 17:44 556K 
[SND]sad45.mp32022-08-09 17:44 0  
[SND]zawsze.mp32022-08-09 17:43 0  
[SND]X2Download.com - UN Owen Was Her - Nico Nico Douga ~ Ronald McDonald (128 kbps).mp32022-08-09 17:42 0  
[SND]fabdoua.mp32022-08-09 17:40 0  
[SND]alltype.mp32022-08-09 17:37 0  
[SND]St1.mp32022-08-09 17:35 3.4M 
[SND]SnapTik_7124337818679201050.mp32022-08-09 17:35 0  
[SND]savannah.mp32022-08-09 17:35 0  
[SND]Tulusinteraksi3.mp32022-08-09 17:34 0  
[SND]Tulusjuni2.mp32022-08-09 17:33 0  
[SND]icalsad.mp32022-08-09 17:33 0  
[SND]Pesanterakhir1.mp32022-08-09 17:33 0  
[VID]SnapTik_7126513311683743003.mp42022-08-09 17:30 0  
[SND]Until I Found You 💛Newest Arthur Miguel Non Stop Playlist 2022💛Bagong OPM Ibig Kanta 2022.mp32022-08-09 17:30 0  
[SND]TINDER ROLEPLAY - PROD BY MANGBORIS (Official Audio).mp32022-08-09 17:29 0  
[SND]#AJIMAT⚡ - MY GANG! (Official Music Video).mp32022-08-09 17:27 0  
[SND]sein.mp32022-08-09 17:26 0  
[SND]strumble.mp32022-08-09 17:25 0  
[SND]Dito.mp32022-08-09 17:25 3.5M 
[SND]sikok bagi duo.mp32022-08-09 17:21 0  
[SND]Vendetta - Этот Дым - Miro Pircxalava.mp32022-08-09 17:20 0  
[SND]Скриптонит - Пацан [Chill Vibe Version by ERWI] - Constant Music.mp32022-08-09 17:20 0  
[SND]Иду Как И Шел - INFINITY MUSIC.mp32022-08-09 17:20 0  
[SND]Веселей - Скриптонит.mp32022-08-09 17:20 0  
[SND]ендшпиль-гости уйдут - legenda_13.mp32022-08-09 17:20 0  
[SND]Train Wreck - kizaru.mp32022-08-09 17:20 0  
[SND]Metro Pro - Valiko - Nextgen.mp32022-08-09 17:20 0  
[SND]50 сеnt & Каспийский груз disco inferno - ☠️𝕯𝖊𝖆𝖉𝖑𝛄 𝖒𝖚𝖘𝖎𝖈☠️.mp32022-08-09 17:20 0  
[SND]H8.HOOD - PHANTOM (official music) - 1agares1.mp32022-08-09 17:20 0  
[SND]01. Делюгу - Макухин.mp32022-08-09 17:20 0  
[SND]First Day Out - kizaru.mp32022-08-09 17:20 0  
[SND]DAIS - Glock - DAIS.mp32022-08-09 17:20 0  
[SND]03. Его Крышуют Мусара - Макухин.mp32022-08-09 17:20 0  
[SND]•Как мне жаль ваши души• - Mara$ladkiy.mp32022-08-09 17:19 0  
[SND]TRT.mp32022-08-09 17:19 0  
[SND]2008.mp32022-08-09 17:18 2.1M 
[SND]tom1.mp32022-08-09 17:17 0  
[SND]HUM.mp32022-08-09 17:17 0  
[SND]chien.mp32022-08-09 17:15 0  
[SND]odel.mp32022-08-09 17:14 0  
[SND]yeu.mp32022-08-09 17:14 0  
[SND]TST.mp32022-08-09 17:13 0  
[SND]showw.mp32022-08-09 17:13 0  
[SND]We asked Richard how he integrates rhetoric and phonetic delivery in his training and what is the unique methodology behind it (1).mp32022-08-09 17:12 0  
[SND]FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is gamification company culture (3).mp32022-08-09 17:12 0  
[SND]FIRST CONTACT STORIES OF THE CALL CENTER NOBELBIZ PODCAST. One of Richard Blank’s (CEO of Costa Rica's Call Center) strong suits is balancing his time as a leader (2).mp32022-08-09 17:12 0  
[SND]despacito.mp32022-08-09 17:12 4.3M 
[SND]During COVID-19, Costa Rica's Call Center's CEO, Richard Blank managed to keep having successful interactions, happy customers and engaged employees (1).mp32022-08-09 17:12 0  
[SND]The Art and Science of Call Center Success, with Richard Blank from Costa Rica's Call Center - Cutter Consulting Group.mp32022-08-09 17:11 0  
[SND]aboba.mp32022-08-09 17:10 0  
[SND]DJ Chechen - Чеченская лезгинка.mp32022-08-09 17:08 772K 
[SND]alo.mp32022-08-09 17:08 4.3M 
[SND]arcannistrp.mp32022-08-09 17:06 0  
[SND]arc.mp32022-08-09 17:06 0  
[SND]saep1.mp32022-08-09 17:03 0  
[SND]Dan.mp32022-08-09 17:02 2.4M 
[SND]ngoisao.mp32022-08-09 16:57 0  
[SND]vf.mp32022-08-09 16:56 0  
[SND]sando.mp32022-08-09 16:53 0  
[SND]y2mate.com_-_GTARPNETWORK_Heading.mp32022-08-09 16:52 0  
[SND]itsyouu.mp32022-08-09 16:48 0  
[SND]Diz3.mp32022-08-09 16:47 0  
[SND]wannamarry.mp32022-08-09 16:46 0  
[SND]Defamilita.mp32022-08-09 16:41 0  
[SND]Tadhana.mp32022-08-09 16:37 1.0M 
[SND]ligaya.mp32022-08-09 16:34 444K 
[SND]Katha.mp32022-08-09 16:33 0  
[SND]Ito.mp32022-08-09 16:33 0  
[SND]mhine.mp32022-08-09 16:33 0  
[SND]Ligaya.mp32022-08-09 16:32 0  
[SND]behh.mp32022-08-09 16:32 0  
[SND]Tokyo Ghoul - Opening (original).mp32022-08-09 16:32 0  
[SND]6IX9INE - POLICE ft. 50 Cent (RapKing Music Video)(MP3_320K).mp32022-08-09 16:31 0  
[SND][YT2mp3.info] - Mehro - perfume (Lyrics) (320kbps).mp32022-08-09 16:31 0  
[SND]kane + ketceh 😎☝.mp32022-08-09 16:27 0  
[SND]m49.mp32022-08-09 16:26 0  
[SND]lot.mp32022-08-09 16:26 0  
[SND]kash.mp3.mp32022-08-09 16:25 0  
[SND]youu.mp32022-08-09 16:25 0  
[SND]FiiyOzawa.mp32022-08-09 16:22 0  
[SND]DanMachi Season 4 Opening FullTentouby Sajou no Hana.mp32022-08-09 16:21 0  
[SND]Liga.mp32022-08-09 16:21 0  
[SND]Mine.mp32022-08-09 16:20 0  
[SND]BASS.mp32022-08-09 16:20 0  
[SND]inbound6601697356567906970.mp32022-08-09 16:16 0  
[SND]Metan_-_SHnurki_73239954.mp32022-08-09 16:16 0  
[SND]BASS1.mp32022-08-09 16:15 0  
[SND]y2mate.com - DJ JEDAG JEDUG FULL BASS Lagu tik tok viral 2021 WilfexBor Terbaru (1).mp32022-08-09 16:15 0  
[SND]inbound7796932345223699318.mp32022-08-09 16:14 0  
[SND]ajh.mp32022-08-09 16:08 0  
[SND]musica-the-descent-kevin-macleod.mp32022-08-09 16:07 0  
[SND]wax1.mp32022-08-09 16:05 0  
[SND]trac.mp32022-08-09 16:05 0  
[SND]zlij_reper_zenik_-_gmo_(z2.fm).mp32022-08-09 15:58 0  
[SND]TP1.mp32022-08-09 15:48 0  
[SND]Sound1.mp32022-08-09 15:48 0  
[SND]Zxa12.mp32022-08-09 15:48 0  
[SND]Zxa11.mp32022-08-09 15:47 0  
[SND]Zxa10.mp32022-08-09 15:47 0  
[SND]lil-tecca-ransom-directed-by-cole-bennett-ytmp3juice.mp32022-08-09 15:45 0  
[SND]tiktok-i-just-can-t‼️-kevin-rater-remix-2021-ytmp3juice.mp32022-08-09 15:45 0  
[SND]mzlff-Нерпы все в адидасах (Original Version) [Peanzo Remix].mp32022-08-09 15:43 0  
[SND]DJBLDABTCH.mp32022-08-09 15:43 0  
[SND]LZ1.mp32022-08-09 15:42 0  
[SND]LZ3.mp32022-08-09 15:42 0  
[SND]LZ2.mp32022-08-09 15:42 0  
[SND]LZ5.mp32022-08-09 15:42 0  
[SND]LZ7.mp32022-08-09 15:42 0  
[SND]LZ6.mp32022-08-09 15:42 0  
[SND]Skofka_Nu_a_poki_budem_bit_vas_za_azov_i_Buchu.mp32022-08-09 15:41 0  
[SND]Eorp.mp32022-08-09 15:39 0  
[SND]high.mp32022-08-09 15:38 0  
[SND]y2mate.com - Rizky Febian Seperti Kisah Official Lyric Video.mp32022-08-09 15:37 0  
[SND]LZ.mp32022-08-09 15:36 2.4M 
[SND]DJ BUILD A BITCH.mp32022-08-09 15:35 0  
[SND]ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง.mp32022-08-09 15:35 0  
[SND]ตบไมเคิ้ลเนเวอร์เฟียร์ By ทุเรียนซิ่ง (online-audio-converter.com).mp32022-08-09 15:34 0  
[SND]nai.mp32022-08-09 15:32 0  
[SND]vadcb.mp32022-08-09 15:29 0  
[SND]y2mate.com - iPhone New phone ringtone 2020 Best iPhone ringtone 2020 Apple ringtone 2020 download.mp32022-08-09 15:27 0  
[SND]Song10.mp32022-08-09 15:26 0  
[SND]HEE.mp32022-08-09 15:20 2.8M 
[SND]y2mate.com - I Like You So Much Youll Know It Ysabelle Cuevas Lyrics .mp32022-08-09 15:15 1.0M 
[SND]jackking.mp32022-08-09 15:14 0  
[SND]megalovania.mp32022-08-09 15:13 0  
[SND]mp3-2217615439921085-160687952498285.mp32022-08-09 15:13 0  
[SND]bls9.mp32022-08-09 15:12 0  
[SND]zaxn1.mp32022-08-09 15:10 0  
[SND]life.mp32022-08-09 15:10 0  
[SND]joby102.mp32022-08-09 15:06 0  
[SND]ransom.mp32022-08-09 15:04 0  
[SND]incalabas3.mp32022-08-09 15:03 0  
[SND]U-Rays (Tutorial) - F-Zero GX [OST].mp32022-08-09 15:03 232K 
[SND]oopkmmmm.mp32022-08-09 15:03 0  
[SND]9amincalabasas.mp32022-08-09 15:02 0  
[SND]ll1.mp32022-08-09 15:02 0  
[SND]FFMAX.mp32022-08-09 15:00 0  
[SND]kkkkkkkho.mp32022-08-09 14:59 3.1M 
[SND]walk.mp32022-08-09 14:59 4.2M 
[SND]chuta5.mp32022-08-09 14:58 0  
[SND]chuta4.mp32022-08-09 14:58 0  
[SND]chuta3.mp32022-08-09 14:58 0  
[SND]chuta2.mp32022-08-09 14:58 0  
[SND]chuta.mp32022-08-09 14:58 0  
[SND]chuta1.mp32022-08-09 14:58 0  
[SND]Travis Scott - Antidote (Lyrics On Screen).mp32022-08-09 14:56 0  
[SND]y2mate.com - Arctic Monkeys I Wanna Be Yours Lyrics.mp32022-08-09 14:56 0  
[SND]CallGirl-TrungTu-7344918.mp32022-08-09 14:53 0  
[SND]Redoxy Был друг стал враг_9zbk.mp32022-08-09 14:50 0  
[SND]vacation.mp32022-08-09 14:50 0  
[SND]uuwian.mp32022-08-09 14:49 0  
[SND]paypal-hold-song.mp32022-08-09 14:49 0  
[SND]savage.mp32022-08-09 14:49 0  
[SND]options.mp32022-08-09 14:48 0  
[SND]lintik.mp32022-08-09 14:48 0  
[SND]lifegoeson.mp32022-08-09 14:48 3.2M 
[SND]kungikay.mp32022-08-09 14:47 1.5M 
[SND]itsyou.mp32022-08-09 14:47 1.5M 
[SND]ispy.mp32022-08-09 14:47 0  
[SND]heatwaves.mp32022-08-09 14:47 3.2M 
[SND]habangbuhay.mp32022-08-09 14:46 3.8M 
[SND]deathbed.mp32022-08-09 14:46 1.1M 
[SND]comethru.mp32022-08-09 14:46 0  
[SND]chilllang.mp32022-08-09 14:46 4.5M 
[SND]buwan.mp32022-08-09 14:45 7.8M 
[SND]bilog.mp32022-08-09 14:45 1.5M 
[SND]beautiful.mp32022-08-09 14:45 4.5M 
[SND]io1.mp32022-08-09 14:41 0  
[SND]Pa.mp32022-08-09 14:39 0  
[SND]Pala1.mp32022-08-09 14:38 0  
[SND]Tiara01.mp32022-08-09 14:37 0  
[SND]snowfall.mp32022-08-09 14:37 0  
[SND]wells-hold-song.mp32022-08-09 14:37 1.3M 
[SND]prokol.mp3.mp32022-08-09 14:36 0  
[SND]Glen1.mp32022-08-09 14:34 0  
[SND]Pala.mp32022-08-09 14:33 1.5M 
[SND]Newsong70.mp32022-08-09 14:31 0  
[SND]Glen17.mp32022-08-09 14:31 1.1M 
[SND]topromanticsong.mp32022-08-09 14:31 0  
[SND]PALEDES.mp32022-08-09 14:28 0  
[SND]bass.mp32022-08-09 14:28 4.9M 
[SND]djcuky2.mp32022-08-09 14:26 1.1M 
[SND]Wells Fargo Hold Music (2021).mp32022-08-09 14:21 1.3M 
[SND]Theo1.mp32022-08-09 14:21 135K 
[SND]Sukzessive Approximation (DJ Cannabis Coffeeshops Deutschland).mp32022-08-09 14:20 0  
[SND]2019-03-17_-_Too_Crazy_-_David_Fesliyan.mp32022-08-09 14:19 0  
[SND]Lucky1.mp32022-08-09 14:14 0  
[SND]Sad3.mp32022-08-09 14:13 840K 
[SND][YT2mp3.info] - Joji - Glimpse of Us (320kbps).mp32022-08-09 14:10 8.9M 
[SND]VaGanza.mp32022-08-09 14:10 0  
[SND][YT2mp3.info] - Beach Bunny - Cloud 9 (Official Music Video) (320kbps).mp32022-08-09 14:09 0  
[SND]rascal.mp32022-08-09 14:05 0  
[SND]Highway.mp32022-08-09 14:03 0  
[SND]FullSenyum.mp32022-08-09 13:59 4.2M 
[SND]LOVE.mp32022-08-09 13:59 0  
[SND]panda.mp32022-08-09 13:56 4.8M 
[SND]PecahSeribu.mp32022-08-09 13:56 0  
[SND]test1.mp32022-08-09 13:54 4.2M 
[SND]life3.mp32022-08-09 13:53 0  
[SND]cars1.mp32022-08-09 13:52 0  
[SND]Djfede1.mp32022-08-09 13:48 0  
[SND]kolor.mp32022-08-09 13:46 0  
[SND]SAMSONS.mp32022-08-09 13:44 0  
[SND]ganda.mp32022-08-09 13:40 0  
[SND]Hills.mp32022-08-09 13:39 0  
[SND]PARALUMAN.mp32022-08-09 13:39 0  
[SND]RagnBone Man - Human.mp32022-08-09 13:35 0  
[SND]prombl_-_myulee_(musmore.com).mp32022-08-09 13:30 0  
[SND]Sweet.mp32022-08-09 13:28 3.4M 
[SND]Mehabooba.mp32022-08-09 13:27 1.2M 
[SND]Chill.mp32022-08-09 13:25 72K 
[SND]Bmw.mp32022-08-09 13:24 2.5M 
[SND]abtag5.mp32022-08-09 13:22 0  
[SND]moonnik.mp32022-08-09 13:19 0  
[SND]MOON.mp32022-08-09 13:17 0  
[SND]THUONGQUAXA.mp32022-08-09 13:17 0  
[SND]united in flames cut.mp32022-08-09 13:16 0  
[SND]KaiZ2.mp32022-08-09 13:13 0  
[SND]EroplanongPapel.mp32022-08-09 13:12 0  
[SND]Until5.mp32022-08-09 13:12 0  
[SND]Idealessappealing.mp32022-08-09 13:09 0  
[SND]AMALEDI (1).mp32022-08-09 13:09 0  
[SND]PTT-20220809-WA0025.mp32022-08-09 13:08 0  
[SND]box.mp32022-08-09 13:08 1.8M 
[SND]Fai Rumore (ESC 2022 SF1 Live).mp32022-08-09 13:07 0  
[SND]Asmodeus - AI.mp32022-08-09 13:07 0  
[SND]y2meta.com - Last Child - DUKA (Official Lyric Video) (128 kbps).mp32022-08-09 13:05 0  
[SND]ssstik.io_1659706519639.mp32022-08-09 13:05 0  
[SND]Beruntung.mp32022-08-09 13:04 0  
[SND]Asmodeus - AI.m4a2022-08-09 13:04 0  
[SND]parti2.mp32022-08-09 13:01 0  
[SND]playlist-sad-2hour.mp32022-08-09 13:00 0  
[SND]haroun.mp32022-08-09 12:58 0  
[SND]Rain World THS - Garbage City Shuffle.mp32022-08-09 12:55 0  
[SND]dangdutslebew1.mp32022-08-09 12:55 0  
[SND]inbound4252352553164717993.mp32022-08-09 12:55 0  
[SND]snap1.mp32022-08-09 12:54 0  
[SND]tegar.mp32022-08-09 12:52 3.6M 
[SND]Darci2.mp32022-08-09 12:51 0  
[SND]Big_Baby_Tape_kizaru_-_99_Problems_73212020.mp32022-08-09 12:51 6.2M 
[SND]better.mp32022-08-09 12:50 3.2M 
[SND]y2mate.com - Eyes blue or brown cant remember terpikat senyummu Heather X Eyes Blue Lirik Dan Terjemahan.mp32022-08-09 12:50 0  
[SND]Luha.mp32022-08-09 12:50 0  
[SND]y5.mp32022-08-09 12:50 0  
[SND]y4.mp32022-08-09 12:50 0  
[SND]y2.mp32022-08-09 12:49 0  
[SND]y3.mp32022-08-09 12:49 0  
[SND]y1.mp32022-08-09 12:49 0  
[SND]Ballin Down.mp32022-08-09 12:47 0  
[SND]Porque.mp32022-08-09 12:45 0  
[SND]mp1.mp32022-08-09 12:41 1.7M 
[SND]Darci.mp32022-08-09 12:39 0  
[SND]Kambulat — Но ты кидаешь в игнор (Muzqa.net) (www.lightaudio.ru).mp32022-08-09 12:38 0  
[SND]Empilight.mp32022-08-09 12:36 0  
[SND]Oliver.mp32022-08-09 12:36 0  
[SND]ЛИТВИНЕНКО - Исправим.mp32022-08-09 12:36 2.4M 
[SND]y2mate.com - DARCION MY OWN LYRICS.mp32022-08-09 12:35 0  
[SND]JIKA.mp32022-08-09 12:32 0  
[SND]Har20.mp32022-08-09 12:31 3.6M 
[SND]tiengxehoi.mp32022-08-09 12:21 0  
[SND]y2mate.com - New GM ChevyGMCCadillac Door Chime Sound Effect HQ.mp32022-08-09 12:20 0  
[SND]adsasdasd.mp32022-08-09 12:12 0  
[SND]vjudjhfgkvgz.mp32022-08-09 12:11 0  
[SND]bollywoodFM - Детство.mp32022-08-09 12:11 3.0M 
[SND]1650353842_2xrkrnskpsn2022rk8fbcq0k128kbs.mp32022-08-09 12:08 8.8M 
[SND]washing.mp32022-08-09 12:05 1.8M 
[SND]mscrumby.mp32022-08-09 12:04 2.1M 
[SND]nokomens.mp32022-08-09 11:54 5.9M 
[SND]rfquake.mp32022-08-09 11:52 4.2M 
[SND]lmanana.mp32022-08-09 11:51 8.8M 
[SND]crmby.mp32022-08-09 11:51 2.1M 
[SND]campuran.mp32022-08-09 11:48 53M 
[SND]Crazy - Patrick Patrikios.mp32022-08-09 11:44 5.1M 
[SND]s2.mp32022-08-09 11:38 4.3M 
[SND]10.mp32022-08-09 11:35 172K 
[SND]Iskorpio - MABAGHICH (Official Music Audio).[Mpgun.com].mp32022-08-09 11:32 0  
[SND]naruto.mp32022-08-09 11:32 0  
[SND]rege2.mp32022-08-09 11:31 0  
[SND]XD.mp32022-08-09 11:31 0  
[SND]KarnaMereka - Cerita Malam (Lirik).mp32022-08-09 11:30 0  
[SND]Randa1.mp32022-08-09 11:29 1.5M 
[SND]Akin.mp32022-08-09 11:28 0  
[SND]dopan.mp32022-08-09 11:27 0  
[SND]KLIA.mp32022-08-09 11:27 0  
[SND]vtornik_-_Dzhoni_Vonker_73215538.mp32022-08-09 11:25 0  
[SND]mp5.mp32022-08-09 11:25 4.9M 
[SND]listrap1.mp32022-08-09 11:24 22M 
[SND]listrap.mp32022-08-09 11:24 19M 
[SND]KVA1.mp32022-08-09 11:21 128K 
[SND]kelaz.mp32022-08-09 11:16 0  
[SND]ha1.mp32022-08-09 11:16 1.8M 
[SND]mp3.mp32022-08-09 11:15 1.1M 
[SND]AUD-20220124-WA0172.mp32022-08-09 11:13 0  
[SND]SNA.mp32022-08-09 11:13 0  
[SND]Кино - Закрой за мной дверь, я ухожу.mp32022-08-09 11:12 0  
[SND]no3.mp32022-08-09 11:12 0  
[SND]SHINE7.mp32022-08-09 11:12 0  
[SND]Beethoven Violin concerto 3rd movement, Toshiya Eto soloist.mp32022-08-09 11:11 0  
[SND]no1.mp32022-08-09 11:09 0  
[VID]WhatsApp Audio 2022-08-08 at 11.06.32 AM.mp42022-08-09 11:09 0  
[SND]no2.mp32022-08-09 11:08 0  
[SND]Jakomo, A.V.G, MACAN - Самый молодой.mp32022-08-09 11:08 0  
[SND]🔊💣😈Iliusha🔊💣😈-🖤 Пару водников 🖤-kissvk.com.mp32022-08-09 11:07 0  
[SND]ТГК - Там таз стелит.mp32022-08-09 11:07 1.0M 
[SND]ha.mp32022-08-09 11:06 2.0M 
[SND]ilja_toka__tutbass_-_ilja_toka__tam__gde_nam_ksenon_osveshchaet_tuman_(z2.fm).mp32022-08-09 11:03 6.6M 
[VID]DJ1.mp42022-08-09 11:02 0  
[SND]PD.mp32022-08-09 10:59 2.3M 
[SND]Диман Брюханов - Давай вкатаемся братан_(muzfan.net).mp32022-08-09 10:59 7.1M 
[SND]sed1.mp32022-08-09 10:58 0  
[SND]Liam1.mp32022-08-09 10:57 7.5M 
[SND]Mr. Credo - Медляк (CXNVTVS flip) (www.hotplayer.ru).mp32022-08-09 10:56 0  
[SND]ask.mp32022-08-09 10:56 0  
[SND]Randa3.mp32022-08-09 10:55 0  
[SND]SM.mp32022-08-09 10:55 3.0M 
[SND]Randa.mp32022-08-09 10:54 3.4M 
[SND]Chin-Giz - Ствол.mp32022-08-09 10:53 5.5M 
[SND]Need You Lyrics Ex Battalion ft Jroa.mp32022-08-09 10:50 0  
[SND]PLVTINUM Tarro Champagne Sunshine Lyrics British men do it best TikTok Song.mp32022-08-09 10:50 0  
[SND]tite.mp32022-08-09 10:49 0  
[SND]gamitin nang babae.mp32022-08-09 10:48 0  
[SND]The Walters I Love You So.mp32022-08-09 10:48 0  
[SND]Like A Virgin Lyrics Video Madonna.mp32022-08-09 10:48 0  
[SND]Aqua Barbie Girl.mp32022-08-09 10:47 0  
[SND]Lo Ki Manifest Official Music Video.mp32022-08-09 10:47 1.4M 
[SND]David3.mp32022-08-09 10:47 2.3M 
[SND]Philippine National Anthem Lupang Hinirang TLEN.mp32022-08-09 10:47 0  
[SND]PH.mp32022-08-09 10:44 0  
[SND]SPEEDY SOUNDS & ENTERTAINMENT PIANO MIX #003.mp32022-08-09 10:42 0  
[SND]Who's Lovin You.mp32022-08-09 10:40 0  
[SND]Tickle me pink.mp32022-08-09 10:39 0  
[SND]Lintik.mp32022-08-09 10:37 0  
[SND]sbw1.mp32022-08-09 10:36 0  
[SND]dgn1.mp32022-08-09 10:33 0  
[SND]y2mate.com - Juice WRLD The Weeknd Smile Official Video.mp32022-08-09 10:29 0  
[SND]joji_glimpse_of_us_1062941230036325777.mp32022-08-09 10:28 0  
[SND]djsalira.mp32022-08-09 10:28 0  
[SND]Joji-SLOW-DANCING-IN-THE-DARK_K3Qzzggn--s.mp32022-08-09 10:28 0  
[SND]before-I-close-my-eyes_2EpBqtqf8Go.mp32022-08-09 10:27 0  
[SND]y2mate.com - Juice WRLD Empty Official Audio.mp32022-08-09 10:27 0  
[SND]y2mate.com - Rich Brian Yellow ft Bekon Official Video.mp32022-08-09 10:27 0  
[SND]y2mate.com - Rich Brian Drive Safe Lyric Video.mp32022-08-09 10:26 0  
[SND]想見你.mp32022-08-09 10:22 1.8M 
[SND]atlanta.mp32022-08-09 10:19 4.4M 
[SND]beatgat1.mp32022-08-09 10:19 220K 
[SND]beatgat.mp32022-08-09 10:19 2.5M 
[SND]beat1.mp32022-08-09 10:19 2.3M 
[SND]morgenshtern-timati-el-problema-mp3.mp32022-08-09 10:16 5.3M 
[SND]trekkkk.mp32022-08-09 10:13 0  
[SND]alt-J - Breezeblocks (Lyrics).mp32022-08-09 10:11 0  
[SND]-_Pro_samp_rp_(Gybka.com).mp32022-08-09 10:09 0  
[SND]morgenshtern-eldzhej-cadillac-club-remix-by-skazka-music-mp3.mp32022-08-09 10:09 0  
[SND]lexzy3.mp32022-08-09 10:06 0  
[SND]sasageo.mp32022-08-09 10:05 0  
[SND]Ginn_Song_1.mp32022-08-09 10:02 0  
[SND]Ginn_Song_11.mp32022-08-09 10:01 0  
[SND]Ginn_Song_12.mp32022-08-09 10:01 0  
[SND]Ginn_Song_2.mp32022-08-09 10:01 0  
[SND]Ginn_Song_7.mp32022-08-09 09:59 0  
[SND]Ginn_Song_13.mp32022-08-09 09:59 0  
[SND]Miyagi, Andy Panda - Utopia (mp3day.net).mp32022-08-09 09:58 0  
[SND]Ginn_Song_6.mp32022-08-09 09:58 0  
[SND]Ginn_Song_9.mp32022-08-09 09:58 0  
[SND]Ginn_Song_4.mp32022-08-09 09:58 0  
[SND]FAJRIA.mp32022-08-09 09:57 0  
[SND]Ginn_Song_10.mp32022-08-09 09:57 0  
[SND]Ginn_Song_3.mp32022-08-09 09:56 0  
[SND]ganvest-durnaya-mp3.mp32022-08-09 09:56 0  
[SND]для мта 8 — военкомат (www.lightaudio.ru).mp32022-08-09 09:53 0  
[SND]Happy Asmara - Tatu [OFFICIAL].mp32022-08-09 09:53 0  
[SND]WOW.mp32022-08-09 09:51 0  
[SND]lexzy1.mp32022-08-09 09:49 0  
[SND]love3.mp32022-08-09 09:48 0  
[SND]hcdbf.mp32022-08-09 09:47 0  
[SND]Djpk1.mp32022-08-09 09:46 0  
[SND]Ебанько - Я ебу собак.mp32022-08-09 09:46 2.2M 
[SND]AUD-20220809-WA0308.mp32022-08-09 09:46 0  
[SND]efekgedhangkluthuk.mp32022-08-09 09:35 0  
[SND]qwe.mp32022-08-09 09:31 2.6M 
[SND]⛱ Travel Vlog No Copyright Chill Summer Background Music for Video _ Anywhere by shandr & Nick Perry (2).mp32022-08-09 09:31 0  
[SND]Ебанько - Еби меня.mp32022-08-09 09:30 0  
[SND]Ginn_Song_5.mp32022-08-09 09:30 0  
[SND]atme.mp32022-08-09 09:30 0  
[SND]phulu.mp32022-08-09 09:27 0  
[SND]AUD-20220809-WA0314.m4a2022-08-09 09:27 0  
[SND]remixx.mp32022-08-09 09:25 0  
[SND]duka.mp32022-08-09 09:23 5.1M 
[VID]sms.mp42022-08-09 09:19 78K 
[VID]GABUT2.mp42022-08-09 09:17 0  
[VID]GABUT1.mp42022-08-09 09:17 0  
[SND]india.mp32022-08-09 09:17 0  
[SND]dangdut3.mp32022-08-09 09:16 0  
[SND]dangdut2.mp32022-08-09 09:16 1.4M 
[SND]Baby.mp32022-08-09 09:15 2.0M 
[SND]gamora_-_bazaru_net_(z2.fm).mp32022-08-09 09:08 0  
[VID]VID-20220731-WA0012.mp42022-08-09 09:08 3.1M 
[SND]Dije2.mp32022-08-09 09:07 2.7M 
[VID]VID-20220724-WA0006.mp42022-08-09 09:07 0  
[SND]Joko tingkirr.mp32022-08-09 09:06 5.3M 
[SND]Awd1.mp32022-08-09 09:03 148K 
[SND]Asb1.mp32022-08-09 08:59 0  
[SND]CN - Atomwaffen Division.mp32022-08-09 08:56 0  
[SND]Brk1.mp32022-08-09 08:50 0  
[SND]bro2.mp32022-08-09 08:47 0  
[SND]Dd1.mp32022-08-09 08:47 0  
[SND]Gg33.mp32022-08-09 08:47 400K 
[SND]PANICX, SH3TLVIZ - Give Em Hell.mp32022-08-09 08:45 0  
[SND]Strom1.mp32022-08-09 08:44 0  
[SND]Music Cover l 66,We are Badguy,JAK Founder (RB Version).mp32022-08-09 08:42 0  
[SND]TBA.mp32022-08-09 08:38 0  
[SND]tose1.mp32022-08-09 08:36 0  
[SND]seto5.mp32022-08-09 08:31 0  
[SND]AZBest5.mp32022-08-09 08:21 0  
[SND]renz1.mp32022-08-09 08:21 0  
[SND]AZBest2.mp32022-08-09 08:21 0  
[SND]AZBest3.mp32022-08-09 08:21 0  
[SND]AZBest1.mp32022-08-09 08:21 0  
[SND]Debt Collection - Outbound - Follow-up call.mp32022-08-09 08:20 0  
[SND]AsiaZoneRPBest4.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest2.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest1.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest5.mp32022-08-09 08:19 0  
[SND]AsiaZoneRPBest3.mp32022-08-09 08:18 0  
[SND]genggeng.mp32022-08-09 08:17 300K 
[SND]01 DJ CONRAY - HELLO SUMMER AMAPIANO MIX (1).mp32022-08-09 08:16 0  
[SND]gang.mp32022-08-09 08:12 0  
[SND]D42_3.mp32022-08-09 08:10 0  
[SND]vip3.mp32022-08-09 08:06 0  
[SND]D42_2.mp32022-08-09 08:05 0  
[SND]D42_1.mp32022-08-09 08:05 0  
[SND]laskarpelangi.mp32022-08-09 08:04 3.1M 
[SND]sabilulung.mp32022-08-09 08:03 2.6M 
[SND]yt1s.com - Breaking Bad Main Title Theme Extended.mp32022-08-09 08:03 0  
[SND]partyfavor.mp32022-08-09 08:01 3.7M 
[SND]vserana.mp32022-08-09 07:59 0  
[SND]DJ AINT MY FAULT SLOWED VIRAL TIK TOK TERBARU 2022 YANG KALIAN CARI .mp32022-08-09 07:58 2.3M 
[SND]D44.mp32022-08-09 07:57 232K 
[SND]DJ+TELOLET+BY+DJ+SOPAN.mp32022-08-09 07:55 0  
[SND]D42.mp32022-08-09 07:55 0  
[SND]bibo.mp32022-08-09 07:55 0  
[SND]lc.mp32022-08-09 07:55 0  
[SND]asede.mp32022-08-09 07:54 0  
[SND]serana.mp32022-08-09 07:53 0  
[SND]cium.mp32022-08-09 07:52 0  
[SND]sempurna.mp32022-08-09 07:50 4.0M 
[SND]love.mp32022-08-09 07:47 1.2M 
[SND]bentrentanglau.mp32022-08-09 07:46 0  
[SND]beauty.mp32022-08-09 07:44 0  
[SND]december.mp32022-08-09 07:42 3.3M 
[SND]kaso.mp32022-08-09 07:38 0  
[SND]loguo1.mp32022-08-09 07:37 2.4M 
[SND]MAXMENGKEREN.mp32022-08-09 07:37 451K 
[SND]xdhii1.mp32022-08-09 07:36 0  
[SND]7125391394302429978.mp32022-08-09 07:35 0  
[SND]MuthukaleIkkaethittund.mp32022-08-09 07:33 0  
[SND]xz.mp32022-08-09 07:31 3.2M 
[SND]co.mp32022-08-09 07:30 2.9M 
[SND]hmaz1.mp32022-08-09 07:29 3.8M 
[SND]AUD-20220729-WA0004.mp32022-08-09 07:28 209K 
[SND]flyme.mp32022-08-09 07:27 2.9M 
[VID]100.000.k_1659661158_musicaldown.com.mp42022-08-09 07:27 1.8M 
[SND]secretlove.mp32022-08-09 07:26 3.8M 
[SND]beachbunny1.mp32022-08-09 07:22 2.3M 
[SND]acabo.mp32022-08-09 07:19 8.1M 
[SND]remix2.mp32022-08-09 07:18 4.5M 
[SND]kutahan.mp32022-08-09 07:17 1.2M 
[SND]Radita.mp32022-08-09 07:11 120K 
[SND]wonder.mp32022-08-09 07:08 2.7M 
[SND]slow.mp32022-08-09 07:08 1.2M 
[SND]phonk-killer-green-orxnge-madness_104015874.mp32022-08-09 07:03 0  
[SND]theshade.mp32022-08-09 06:59 1.9M 
[SND]Sidekick.mp32022-08-09 06:55 0  
[SND]tam2000.mp32022-08-09 06:54 0  
[SND]yss.mp32022-08-09 06:51 0  
[SND]y2mate.com - DJ SIKOK BAGI DUO REMIX PALEMBANG JEDAG JEDUG MENGKANE VIRAL TIKTOK (2).mp32022-08-09 06:43 0  
[SND]لحن حزين بدون كلمات 2021 - موسيقى حزينة تخليك تراجع أفعالك 💔.mp32022-08-09 06:42 0  
[SND]undertel.mp32022-08-09 06:39 0  
[SND]mxnarchNightwing.mp32022-08-09 06:38 0  
[SND]1630639076_fogel-bogatymi-2.mp32022-08-09 06:38 0  
[SND]bones-hdmi-chopped-and-screwed-by-hardhammi.mp32022-08-09 06:34 0  
[SND]Rock.mp32022-08-09 06:33 5.1M 
[SND]120080oon-120071eity-go_456240723.mp32022-08-09 06:32 0  
[SND]FindMyName - Show me your back.mp32022-08-09 06:31 0  
[SND]M.mp32022-08-09 06:31 2.4M 
[SND]xxxmanera-NeverBrokeAgain(musmore.com).mp32022-08-09 06:30 0  
[SND]Canon.mp32022-08-09 06:29 0  
[SND]taktau.mp32022-08-09 06:26 1.2M 
[SND]broker.mp32022-08-09 06:25 2.8M 
[SND]Lugowo.mp32022-08-09 06:22 8.4M 
[SND]y2mate.m4a2022-08-09 06:21 958K 
[SND]geng02.mp32022-08-09 06:20 2.6M 
[SND]geng01.mp32022-08-09 06:20 4.4M 
[SND]s8.mp32022-08-09 06:17 0  
[SND]Neo.mp32022-08-09 06:16 0  
[SND]DIL2.mp32022-08-09 06:14 0  
[SND]DIL1.mp32022-08-09 06:14 0  
[SND]DIL3.mp32022-08-09 06:14 0  
[SND]final_62f18d113ce3bf0066abf1b0_130277.mp32022-08-09 06:08 0  
[SND]prescriptionkid.mp32022-08-09 06:07 0  
[SND]Ito Ang Liga PBA.mp32022-08-09 06:07 0  
[SND]Djviraltt.mp32022-08-09 06:04 0  
[SND]dappam.mp3.mp32022-08-09 06:01 0  
[SND]die.mp32022-08-09 05:58 4.0M 
[SND]One.mp32022-08-09 05:56 4.2M 
[SND][lagu1s.com]TRICKSTER ANTHEM.oE6DQp1BAP8.mp32022-08-09 05:54 0  
[SND]Czerny op.849 no.1.mp32022-08-09 05:52 0  
[SND]teriak.mp32022-08-09 05:49 3.3M 
[SND]tipex.mp32022-08-09 05:46 2.7M 
[SND]ssstik_1652526939748.mp32022-08-09 05:46 0  
[SND]ssstik.io_1653374373576.mp32022-08-09 05:44 0  
[SND]ZentaMusicyea.mp32022-08-09 05:44 0  
[SND]Opasnyjj_-_Opasnyjj_khud_71073513.mp32022-08-09 05:43 0  
[SND]JEldzhi_-_Mojj_Rajjon_69081944.mp32022-08-09 05:42 0  
[SND]Sektor_Gaza_-_CHastushki_55189352.mp32022-08-09 05:38 7.7M 
[SND]s5.mp32022-08-09 05:33 3.8M 
[SND]the-smiths-the-boy-with-the-thorn-in-his-side.mp32022-08-09 05:32 0  
[SND]eldzhey-rastvoritel.mp32022-08-09 05:30 1.7M 
[SND]set12.mp32022-08-09 05:29 2.9M 
[SND]dreamgirl.mp32022-08-09 05:24 0  
[SND]ReZox8.mp32022-08-09 05:18 0  
[SND]WhereIsTheLove.mp32022-08-09 05:16 0  
[SND]seto3.mp32022-08-09 05:16 0  
[SND]DaEK4.mp32022-08-09 05:16 0  
[SND]seto2.mp32022-08-09 05:16 0  
[SND]Ton3.mp32022-08-09 05:15 0  
[SND]YraF5.mp32022-08-09 05:12 0  
[SND]Avtosh_-_Huligan_(iPleer.com).mp32022-08-09 05:11 0  
[SND]BRDYVV_-_Avtosh_Xuligan_66898732.mp32022-08-09 05:11 0  
[SND]Fw5X.mp32022-08-09 05:09 0  
[SND]SrAf5.m4a2022-08-09 05:05 0  
[SND]GARa4s.mp32022-08-09 05:01 0  
[SND]CYSec.mp32022-08-09 05:01 0  
[SND]ZhR24.mp32022-08-09 04:58 0  
[SND]dingincuy.mp32022-08-09 04:58 0  
[SND]SkrA5.mp32022-08-09 04:56 0  
[SND]LeeGa5.mp32022-08-09 04:53 0  
[SND]GaSt1.mp32022-08-09 04:51 0  
[SND]GaSt4.mp32022-08-09 04:49 0  
[SND]Ginn_Song_Lofi_HanyalahMimpi.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Lofi_YangKuInginkan.mp32022-08-09 04:48 0  
[SND]Google.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Yasobi_Daijobu.mp32022-08-09 04:48 0  
[SND]Ginn_Song_Gustixa_Kobbo.mp32022-08-09 04:47 0  
[SND]Ginn_Song_7_Orange.mp32022-08-09 04:47 0  
[SND]Ginn_Song_JKT48_FortuneCookie.mp32022-08-09 04:47 0  
[SND]Ginn_Song_JKT48_SemutMerah.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Lofi_Bersamamu.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Vierra_YangKuInginkan.mp32022-08-09 04:47 0  
[SND]Ginn_Song_Vierra_Seandainya.mp32022-08-09 04:47 0  
[SND]CYS01Q.mp32022-08-09 04:45 0  
[SND]CloseYEyes.mp32022-08-09 04:43 0  
[SND]Dayang23.mp32022-08-09 04:37 7.5M 
[SND]GaSt5.mp32022-08-09 04:36 5.9M 
[SND]Nightcore - Demons.mp32022-08-09 04:35 5.1M 
[SND](Extended) Llusion X Banakula - Midnight Sun (Ramzoid Remix).mp32022-08-09 04:33 9.2M 
[SND]Demi Lovato - Cool For The Summer [vzvuke.net].mp32022-08-09 04:33 0  
[SND]finikfinya__aleks_ataman_-_a_na_rukah_snezhinki_(z2.fm).mp32022-08-09 04:32 0  
[SND]fatbelly__abdr_-_bokal_(slowed_remix)_muzati.net.mp32022-08-09 04:28 0  
[SND]inbound2598099215265422569.mp32022-08-09 04:22 0  
[SND]BAGAIKAN LANGIT - POTRET Piano Cover (1).mp32022-08-09 04:21 0  
[SND]CYS.mp32022-08-09 04:17 0  
[SND]jdMga8.mp32022-08-09 04:15 0  
[SND]ftyuhbb.mp32022-08-09 04:14 0  
[SND]coli.mp32022-08-09 04:11 0  
[SND]Aga2Dj.mp32022-08-09 04:10 0  
[SND]gaR8f.mp32022-08-09 04:06 0  
[SND]united.mp32022-08-09 04:04 0  
[SND]Agazt2.mp32022-08-09 04:01 0  
[SND]XdaGa9.mp32022-08-09 03:58 0  
[SND]XdaGa1.mp32022-08-09 03:56 0  
[SND]GamonDek.mp32022-08-09 03:56 0  
[SND]pakwong.mp32022-08-09 03:51 4.3M 
[SND]indah.mp32022-08-09 03:50 3.7M 
[SND]derixs.mp32022-08-09 03:48 0  
[SND]AgaRa3.mp32022-08-09 03:46 1.7M 
[SND]sai1.mp32022-08-09 03:45 0  
[SND]agS1r.mp32022-08-09 03:44 0  
[SND]KolxChill.mp32022-08-09 03:41 1.1M 
[SND]drumsbums.mp32022-08-09 03:40 2.3M 
[SND]elisha1.mp32022-08-09 03:39 404K 
[SND]ABRAM.mp32022-08-09 03:39 391K 
[SND]resah.mp32022-08-09 03:38 3.3M 
[SND]AgRa4f.mp32022-08-09 03:38 352K 
[SND]rumah.mp32022-08-09 03:35 2.2M 
[SND]AgaTs3.mp32022-08-09 03:34 0  
[SND]BXBXK.mp32022-08-09 03:31 0  
[SND]rain.mp32022-08-09 03:30 1.7M 
[SND]heaven.mp32022-08-09 03:29 5.4M 
[SND]AgaT3.mp32022-08-09 03:28 0  
[SND]Ma.mp32022-08-09 03:26 1.1M 
[SND]Mixx.mp32022-08-09 03:25 1.2M 
[SND]Thin.mp32022-08-09 03:25 1.5M 
[SND]KGF2.mp32022-08-09 03:24 0  
[SND]Ruth B. - Dandelions (Lyrics) slowed reverb (128 kbps) (YTmp3xd.com).mp32022-08-09 03:23 0  
[SND]ฉลามชอบงับคุณ - Bonnadol Feat IIVY B [ เนื้อเพลง ] (1).mp32022-08-09 03:23 2.9M 
[SND]Rafae2.mp32022-08-09 03:21 0  
[SND]LOW.mp32022-08-09 03:17 0  
[SND]malingakala.mp32022-08-09 03:16 156K 
[SND]Rafae1.mp32022-08-09 03:10 4.1M 
[SND]Uyirini Uyire.mp32022-08-09 02:49 0  
[SND]CRUMBY.mp32022-08-09 02:44 0  
[SND]ELMANANA.mp32022-08-09 02:29 0  
[SND]EARFQUAKE.mp32022-08-09 02:23 0  
[SND]Rage Music.mp32022-08-09 02:19 0  
[SND]Track_002.mp32022-08-09 02:11 0  
[SND]Track_001.mp32022-08-09 02:09 0  
[SND]PaperAwaySound.mp32022-08-09 02:03 0  
[SND]vcy.mp3</